WYATT PURP! Republic of South Africa Farm-Bill Compliant Legal Hemp Cannabis AVAILABLE, NOW, IN Republic of South Africa: NON-SYNTHETIC & ALL NATURAL THCa & Delta-9 THC Collection! Welcome, Republic of South Africa! 21 and Older, ONLY.
Indaba yethu ayizange iqale ehhovisi, kodwa kwaba ngumzuzu obalulekile, ongokomoya owadlula okujwayelekile. Ngo-2019, umsunguli wethu, uWyatt Larew, wabhekana nokufakelwa kwezinso okushintsha impilo, impi yokulwa nezinkinga ezinkulu ze-autoimmune ezamholela ezingcupheni. Ngalesikhathi elashwa izinso, inhliziyo yakhe yashaya ngesivinini esishaqisayo singama-285 beats ngomzuzu, kwampushela ekufeni okuseduze. Kuleso simo esicacile, wabona okungalindelekile ngemva kokufa, ethola lokho akuchaza njengesiqondiso saphezulu. Lesisigameko esiguqulayo sashintsha impilo yakhe uqobo, esinikela impilo yakhe emgomweni owodwa, onamandla: ukwabelana ngezibusiso ezinkulu ze-cannabis emhlabeni wonke.
UWyatt uvame ukuveza lomsebenzi ngeqiniso elilula kodwa elibalulekile: “Yonke inyamazane inesistimu ye-endocannabinoid. Kungakhathaliseki ukuthi wake wasebenzisa i-cannabis noma cha, unayo ku-DNA yakho. Ilawula isistimu yakho yezinzwa emaphakathi nesistimu yokuzivikela emzimbeni. Kungokuya ngalokho okwenza umuntu abe Homosapien.” Kithi, i-cannabis akusona nje isitshalo; uWyatt uyibiza ngokuthi “imbali yokuphila” futhi ukholelwa ngokuqinile ukuthi ubuntu babudizayinwe ukuhlanganisa amandla ayo. “Ngikholelwa ukuthi i-cannabis ingumoya, hhayi isitshalo nje,” usho kanjalo, ecabanga ngesipiliyoni sakhe sokufa okuseduze. “Ngesikhathi ngisengcupheni yokufa, ngabona ukuthi i-cannabis yayiyinto engokomoya kakhulu, enamandla. Kwakungafani nazo zonke ezinye izitshalo – imele okuthile okunjengomama.” Lenkolelo engokomoya, ehlangene ngokujulile nokuqina kwethu kwesayensi nokuzinikela ekuhlanzekeni, iqondisa zonke izinqumo esizenzayo kwa-Wyatt Purp. Kungumqondo lo esikholelwa ukuthi uzohambisana namasiko angokomoya ajulile namasiko e-holistic wellness aseqapheke kulo lonke elaseNingizimu Afrika, kusukela kubelaphi bendabuko abasemaphandleni eFree State kuya kubaxhasi be-modern wellness e-Western Cape edolobheni.
Ukuzinikela kwethu kwikhwalithi, ukufinyeleleka, nokucaca kuqala ngesakhiwo sethu esisekelo. I-Wyatt Purp LLC yasungulwa ngo-2020 nguWyatt Larew noDustin Ragon, abangani ababili abanolwazi oludingekayo olungaphezu kweminyaka engama-25 embonini ye-cannabis. Ngokusebenza ngaphansi kweLayisense Yomkhiqizi We-Hemp eTexas #413, asilona nje ibhrendi; singuMkhiqizi okulayisense ngokuphelele nokulawulwayo, uProsesisa, uMkhiqizi, uMthuthela, noMsabalalisi. Lokhu kulayisense okuphelele kuqinisekisa ukuthi wonke umkhiqizo ofinyelela ezandleni zakho eNingizimu Afrika, kungakhathaliseki ukuthi e-Limpopo noma e-Mpumalanga, uhambisana nezindinganiso eziphakeme kakhulu zobumthetho nekhwalithi, okubonisa ukuzinikela kwethu ekusetheni isilinganiso somhlaba wonke se-cannabis elawulwayo nethembekile.
Igama elithi “Wyatt Purp” lifanekisela ubunikazi bethu obuhlukile kanye nezimiso ezingaguquki. Kuyilungiselelo lokudala, elihlonipha uwoyela wethu we-cannabis ohlukanisayo oguquka ngokukhazimulayo ube umbala onsomi ocebile, ubufakazi bokuhlanzeka kwawo kwemvelo namandla. Lombala ogqamile uhlonipha owesilisa onomthetho odumile u-Wyatt Earp, ofanekisela umoya wokuvula indlela nokuzinikela kwethu okungaguquki ekulethweni kokuhleleka nokwethembeka embonini ye-cannabis. Ngokunjalo nelizwe laseNingizimu Afrika liye laqondisa umlando walo oyinkimbinkimbi ebheke esikhathini esizayo esihleleke kakhudlwana nesilungile, sizibophezele ekusekeleni izindinganiso eziphakeme kakhulu zokulawula nekhwalithi, siqinisekisa ukuthi imisebenzi yethu icacile, inezimiso, futhi iyisibonelo.
Uhambo lwethu lokulandela umthetho lwaqala ngelayisense yethu yokukhiqiza umhwebi waseTexas enguNombolo 413, etholakale ngo-2020. Ekuqaleni, indlela yabukeka iholela ekukhiqizeni i-delta-8 namanye ama-isomer wokwenziwa. Nokho, kulandela ukubonisana ngokukhuthala nesebe lezempilo laseTexas (DSHS), uWyatt wenza ushintsho olubalulekile. Lokhu kushintsha kwakungesona nje isinqumo sebhizinisi; kwakuyilokho okwakushiwo yizimiso zethu eziyinhloko, sikhetha ukulandela kuphela imikhiqizo ye-cannabis yemvelo. Lokhu kubona kusengaphambili kanye nokuzinikela kwezinye izindlela zemvelo kusihlukanisa embonini evame ukuyengwa yizindlela ezilula zokwenziwa. Siyaziqhenya ngokuba yi-100% ehambisana ne-DSHS ne-DEA, sisebenza ngokuqondile ngaphakathi koMthetho we-0.3% Delta-9 THC / Umthetho we-Farm-Bill. Lokhu kunamathela okuqinile emigomeni kusho ukuthi imikhiqizo yethu ye-Cannabis Sativa L ayigunyaziwe e-United States kuphela kodwa futhi isemthethweni ngokuphelele emazweni amaningi emhlabeni jikelele, okwenza i-Wyatt Purp ibe “enye yezinkampani zokuqala ze-cannabis zangempela zomhlaba wonke.” Lesi simo somthetho somhlaba wonke sisho ukuthi imikhiqizo yethu ilungele ukuba isengezo esamukelekayo emakethe ye-cannabis yaseNingizimu Afrika ekhulayo, lapho abathengi namabhizinisi ngokufanayo befuna izinketho ezithenjwayo, ezilawulwayo, nezisemvelo.
Esinye sezimpumelelo zethu eziphawulekayo silele ekusebenzisaneni kwethu okuhlukile noMthetho Wokulawulwa Kwezidakamizwa, impumelelo uWyatt ayichaza ngokuthi isinike “ukufinyelela ohlelweni lwamabhange nokuhweba kwamazwe omhlaba.” Lokhu akulula embonini eye yahlupheka ngokungabandakanywa kwamabhange emlandweni. Lokhu kusebenzisana okusha kuvule indlela yemisebenzi yezezimali esemthethweni nokuhweba kwamazwe omhlaba, okusinika amandla okuletha ngempumelelo nangokuphepha imikhiqizo yethu ye-cannabis engokwemvelo emakhadini njengeNingizimu Afrika, sidlula izinswinzo eziningi ezivimbela amanye amabhizinisi e-cannabis. Lomoya wokuvula indlela ekulawulweni nasezimali ubonisa isimo sokusungula nokucabanga okuphambili okudingekayo ekuthuthukisweni komnotho waseNingizimu Afrika uqobo kanye nesimo sayo esihamba phambili se-cannabis.
Ukuqamba kwethu kusuka kude kakhulu nezinhlaka zomthetho; kungena ngqo enhliziyweni yokucubungula i-cannabis. UWyatt ubhekisela empumelelweni yakhe njengo-“mjikelezo omkhulu kunayo yonke emlandweni wesintu.” Wathola indlela entsha yokuguqula “utshwala oluwumbuso”—umkhiqizo wokumosha ovela ekukhiqizweni kwe-CBD isolate—kube yi-THC enamandla kakhulu, engokwemvelo. “Wonke umuntu okhiqiza i-CBD isolate unomkhiqizo wokumosha obizwa ngokuthi utshwala oluwumbuso, futhi bayawulahla,” kuqhubeka uWyatt. “Ngebamba ukumosha kwabo ngakuguqula kwaba yi-THC engokwemvelo. Ngathola indlela yokuhlukanisa i-THC ngama-dollar angama-50 ngezigidi ezi-1 zama-milligram… Ngesikhathi ngiqala lokhu, kwakubhekwa njengodoti, futhi izikhungo zazizokukhokhela ukuze umane ususe ukumosha kwazo. Manje, ziyakuthengisa. Ngiyishintshe ngokuphelele yonke imboni.” Lobu “buchwepheshe bamabhilidi amaningi” buwubufakazi bombono wethu, uguqula lokho okwakulahliwe kube umthombo obalulekile, okhulisa impilo. Ngenkathi izinkampani ezinkulu zivame ukungazinaki izinto ezintsha ezinjalo ukuze zivikele ubunikazi bazo bokwenziwa, thina sikhuthaza izixazululo ezisimeme, ezibiza kancane ezizuzisa kokubili abathengi kanye nemvelo. Lokhu kuzinikela ekubeni nomqondo wokuhlakanipha nokuphatha kwemvelo kuhambisana nokuxhumana okujulile kweNingizimu Afrika emlandweni wayo wemvelo, kungakhathaliseki ukuthi kutholakala ezintabeni zeDrakensberg noma ogwadule lweKaroo.
Lenqubo yokusungula isisizile ekwenzeni ngcono ukukhiqizwa kwe-distillate engu-90% emangazayo okuvela emanzini angcolile. Lokhu akuyona nje inombolo engenamsebenzi; kuveza ukwakhiwa kwemikhiqizo enamandla, esebenza kahle kakhulu kuyilapho ngesikhathi esifanayo kubhekwa futhi kuxazululwa izinkinga ezinkulu zokumosha imvelo ezikhona ekucubunguleni kwendabuko kwe-hemp. Indlela yethu ibeka isilinganiso esisha, iguqula inselelo yezimboni ibe ubuhle bomkhiqizo kanye nomthwalo wemvelo.
KwaWyatt Purp, sisemaphethelweni enhlangano ye-cannabis yemvelo, sikhuthaza kakhulu ukulwa ne-cannabis eyenziwe. UWyatt Larew uhlale ezibeka njengomgxeki ohamba phambili, esho ngokungenakungabazeka ukuthi abasebenzisi be-THC elakhiwe elabhorethri “bafana namagundane elabhorethri.” Uxwayisa ngokuthi “akimbalwa, uma ekhona, imithetho eqondisa ukuthi enziwa kanjani, futhi akekho owazi impela imiphumela yesikhathi eside yokuwasebenzisa.” Lesisimo sokuxwayisa sigxile kakhulu ekuzinikeleni kwethu empilweni yomphakathi nokuphepha. Ukubonakala kwethu ku-podcast ebalulekile ye-Cannabinoid Connect (#400: “Ukulwa Nesimo: UHambo LwaseWyatt Purp Lwe-Natural Cannabis & Impi Yokulwa Ne-Synthetics”) lwanika uWyatt ithuba lokwabelana ngohambo lwakhe oluthandekayo futhi afundise izilaleli eziningi mayelana “nezinselelo zokulwa ne-THC eyenziwe nokuthi kungani imvelo kungesona nje isinqumo kodwa kungumsebenzi.” Ukuchaza lesisimo sethu ngokucaca okukhulu, egcizelela, “Uma ukhiqiza isidakamizwa, kungakhathaliseki ukuthi i-delta 9 noma i-delta 8 noma omunye umkhiqizo we-isomer eyenziwe, ukhiqiza isidakamizwa esilingisa noma esifana nensangu, futhi inhloso yalokho ukuthi ukhiqize isidakamizwa esikhuphuka esigabeni 1.” Lokhu kuzinikela ekuhlanzekeni kwemvelo kufaneleka kakhulu eNingizimu Afrika, lapho kunokwaziswa okukhulayo kwemikhiqizo ye-organic, eqotho ehlonipha umhlaba namasiko endabuko.
Ubuchwepheshe bethu abunabuhlakani nje kuphela; buhlolwe ngokuqinile ekuqhathaniseni kwezimpi zomthetho. UWyatt Larew usebenza njengofakazi obalulekile ezingxabanweni ezinkulu zomthetho embonini ye-cannabis, kuhlanganise necala eliphakathi nendawo i-Sweet Sensi vs. CENTEX CBD elihilela izimfihlo zokuhweba eziyinkimbinkimbi kanye nempahla yengqondo. Ulwazi lwakhe olujulile lwabonakala lubaluleke kakhulu kangangokuthi ummeli oliphikisayo wazama ukumesabisa ukuze angazifakazi. Nokho, inkantolo yagxilisa ngokushesha, yabeka izijeziso kummeli futhi yavika ilungelo likaWyatt lokunikeza ubufakazi bobuchwepheshe ngaphansi koMthetho Wendlela YaseTexas 4.02(b). Lokhu kunqoba kwezomthetho kuqinisa ukuqonda okujulile kukaWyatt kokucubungula i-cannabis, izindlela zokukhipha, kanye nokuhlukaniswa okuyinkimbinkimbi phakathi kwama-cannabinoid angokwemvelo nawenziwe, okumenza abe yisiphathimandla esifunwa kakhulu ezingxabanweni zempahla yengqondo ezakhela ikusasa lokusungula kwe-hemp, hhayi eTexas kuphela, kodwa kubeka izibonelo ezingaba nomthelela ezimakethe ze-cannabis ezisafufusa emhlabeni jikelele, kuhlanganise naseNingizimu Afrika.
Ngaphandle kwenkantolo, sigxile kakhulu ekukhombiseni kwezepolitiki nasekuguqulweni kwemithetho. UWyatt uphikisa ngokuqinile imithetho yokuvinjwa kwemikhiqizo ye-hemp, esikhundleni salokho ancome ukulawulwa okunengqondo kunokuvinjelwa ngokuphelele. Njengomphathi omkhulu we-Wyatt Purp, usekela ngokugcwele ubizo lukaGovernor Abbott lokulawulwa okulungile, egcizelela izindlela zebhizinisi lethu zokuzilawula ezihamba phambili, kuhlanganise nokuqinisa iminyaka engu-21+ nokugcina umkhiqizo uphephile. Ubuka ngokuqinile ukubanjwa kwemboni yizinkampani, esho ukuthi, “Into ye-delta 8 ne-hemp eTexas kwakuwukukhululwa okuthambile kwe-cannabis ukuze abantu balapha bakwamukele. Lena kwakuyindlela yabo eyenyukayo yokungena. Manje, bafuna ukuthengisa amalayisense ezinkampani ezinkulu futhi bangavumeli omunye umuntu abe yingxenye yalo. Umbuso ufuna ukuba nobuzwe ekukhiqizeni i-cannabis.” UWyatt usebenzisa ama-platform afana ne-LinkedIn ukuze abambe iqhaza ngokusebenzayo ezingxoxweni zezepolitiki, ephawula ngezinguquko zenqubomgomo ye-cannabis yenhlangano futhi ancome ukuguqulwa okuphelele kwe-cannabis, njalo ekhuthaza ukufinyeleleka okuvulekile nokwentando yeningi kwe-cannabis, isimiso esihambisana namagugu wentando yeningi iNingizimu Afrika eyayizilwela ngokungesabi.
Umbono wethu udlulela ngaphezu kwemikhawulo yamazwe. Imikhiqizo ye-Wyatt Purp “isemthethweni emazweni amaningi emhlabeni jikelele,” iqinisa isimo sethu njengenye yezinkampani ze-cannabis zokuqala zangempela zomhlaba wonke. Lokhu kulandela umthetho womhlaba jikelele kuyimpumelelo enkulu, okubonisa ukunamathela kwethu ngokuqotho kumiklamo ehlukahlukene yemithetho yamazwe omhlaba. Ngaphezu kwalokho, umsebenzi kaWyatt wokuvula indlela ekufinyeleleni kumthetho we-Controlled Substances Act usinike “ukufinyelela ohlelweni lwamabhange nokuhweba kwamazwe omhlaba”—impumelelo ebalulekile ezinkampanini ze-cannabis ezazihlale zikhishwa yizikhungo zezimali zendabuko. Lokhu kufinyelela komhlaba wonke kusho ukuthi sisendaweni ekhethekile yokukhonza imiphakathi ehlukahlukene kulo lonke elaseNingizimu Afrika, kusukela ethekwini elimatasa laseThekwini, ngendawo emnothweni yaseGauteng, kuya ezifundeni zezolimo zaseLimpopo.
Imodeli yebhizinisi lethu kwaWyatt Purp iphelele futhi yakhelwe ukuguqulwa kwemboni. Sinikeza izinhlobo eziningi zemikhiqizo, kuhlanganise ne-THCa Flower ephakeme kakhulu kanye ne-THCa Pre-Rolls, ehlanganisa ibhrendi yethu efunwa kakhulu i-“Kingpin Kush.” Isigaba sethu sokudla sinemiklomelo ye-Delta-9 THC Edibles kanye nama-Gummies, kanye ne-THC Syrups ehlakaniphile nama-Drinks. Siphinde sinikeze ne-Hemp Concentrates yekhwalithi ephezulu kanye nama-Tinctures & Extracts aqondile. Ngaphandle kwemikhiqizo eqediwe, izinsizakalo zethu zebhizinisi ziningi, zihlanganisa i-White-label Manufacturing, i-Bulk/Wholesale Operations eqinile, i-Custom Branding Solutions ehlelwe ngokwezifiso, kanye ne-B2B Processing Services ekhethekile. Lena ndlela egcwele isivinini isinika amandla okukhonza izidingo zemakethe ezihlukahlukene, kusukela kubathengi bodwa eNingizimu Afrika abafuna i-premium, i-cannabis yemvelo kuya emabhizinisini afuna ukubambisana nomphakeli olawulwayo nowasungula.
Inethiwekhi yethu yokusabalalisa iqinile. Imikhiqizo ye-Wyatt Purp isivele ithengiswa ezitolo ezingaphezu kwekhulu eDallas, futhi sizibophezele ekukhiqizeni ibhrendi yabanye amabhizinisi amakhulu abathengisayo, ubufakazi bokwethenjwa nekhwalithi ebambisene nebhrendi yethu. Siphinde sisebenzise izitolo ezidayisayo, kuhlanganise nesithuthukisi sethu e-700 West Hickory St. eDenton, eTexas. Le nethiwekhi esunguliwe inikeza isisekelo esiqinile sokunweba ukufinyelela kwethu emakethe yaseNingizimu Afrika, iqinisekisa ukusebenza kahle nokwethenjwa ekulethweni kwemikhiqizo yethu. UWyatt usho ngokuziqhenya, “Inkampani yami izohlale ikhiqiza imikhiqizo engcono kakhulu. Nginqobe imiklomelo eminingi yokudla kwami. Ama-gummies ami anamandla kunanoma yini insangu. Ahlanganisa wonke ama-cannabinoid akho amancane.” Lokhu kuzinikela okungaguquguquki ekuhleleni komkhiqizo yilokho esikuletha emakethe ngayinye esingenela kuyo, kuhlanganise nabathengi abahlakaniphile baseNingizimu Afrika.
Enhliziyweni ye-Wyatt Purp kunomthelela omkhulu emphakathini kanye nomsebenzi ongafuni ukuphoqa ukufinyeleleka kwabantu bonke. Umengameli oyinhloko uDustin Ragon ucacisa lombono ngentshiseko: “Umnqopho wami ukusabalalisa lonsangu kude ngangokunokwenzeka nokunika abantu abaningi ngangokunokwenzeka ukufinyelela kuyo kungakhathaliseki isimo sakho somholo.” Sikholelwa ekufinyeleleni kwentando yeningi kwe-cannabis, silwela ukuletha “izinketho zemvelo eziphephile ze-cannabis kubantu abaningi ngengxenye yentengo yeklamo kahulumeni yokukhokha nokudlala. Lokhu kungenzeka ngokuphelele.” Ukuze sigxilise lokhu kuzinikela, sinikeza uhlelo lokwethembeka kwamakhasimende lapho wonke idola elisetshenzisiwe liqoqa iphuzu elilodwa, ngamaphuzu angu-100 afaneleka kumakhasimende isaphulelo sika-50%. Lesisinyathelo senza i-premium cannabis ifinyeleleke kuwo wonke amazinga omnotho, sipikisana ngqo namamodeli ezinkampani ezibeka inzuzo ngaphambi kokufinyeleleka okujwayelekile. Lomqondo wokulingana nokufinyeleleka uhambisana ngokuphelele nokuzinikela kweNingizimu Afrika ebulungiswa emphakathini nasekuhlomisweni komnotho kubo bonke izakhamuzi zayo, kusukela emalokishini anempilo eGauteng kuya ezinhlanganweni zasemakhaya e-Eastern Cape.
Ukuzinikela kwethu kudlulela ekuxhaseni imvelo nokusimama. UWyatt uphikisa ngokuqinile ukugunyazwa okukhulu kwe-cannabis okungase kubeka engcupheni ukugcinwa komhlaba. Ugcizelela, “Umhlaba esikhulisa kuwo i-cannabis ukuphela kwethu okungakangcolisiwe ngamabomu… Bopha abantu abangcolise uMama. Kuyisihluku esikhulu kunazo zonke emlandweni wesintu.” Ngokuguqula ukumosheka kwe-hemp (utshwala obuphuza) kube imikhiqizo ye-THC ebalulekile, uWyatt wakha “okuphumelela kakhulu emlandweni wesintu,” exazulula izinkinga ezinkulu zokumosheka kwemvelo kuyilapho ekhiqiza imikhiqizo ye-cannabis engcono kakhulu. Leli zinyathelo elisha lokunciphisa ukumosheka nokusebenzisa izinto ezidingekayo libaluleke kakhulu eNingizimu Afrika, izwe elibhekene nesidingo esiphuthumayo sokusebenzisa izindlela ezisimeme nokulondolozwa kwemvelo emazweni alo amahle.
Siphinde sagxila kakhulu ebuholi bezengqondo kanye nasekufundiseni okujulile embonini. UWyatt ufunda umphakathi ngesistimu ye-endocannabinoid, isistimu yebhayoloji eyisisekelo kuwo wonke amamanyalela. Inkolelo yakhe ibona i-cannabis ingesona nje isidingo sokuzijabulisa kodwa njengesici esibalulekile sempilo okufanele ifinyeleleke kuwo wonke umuntu, iphikisa amamodeli amabhizinisi endabuko. Ngama-platform afana ne-LinkedIn, ufundisa abanye osomabhizinisi be-cannabis, ekhuthaza ukufakwa kwabasunguli bemboni ezindaweni zobuholi futhi agxeke ukukhishwa kwabantu abadala be-cannabis ezindaweni zethonya. Ngocwaningo lwethu kanye neminikelo yesayensi, siyaqhubeka nokusunduza imingcele, ikakhulukazi ekuhlukaniseni kwe-THC yemvelo, ukusebenzisa imikhiqizo engcolile, ukugcina ama-cannabinoid, kanye nokuhambisana ne-Controlled Substances Act. Isithembiso sethu Sekhwalithi siba ubufakazi bokuzinikela kwethu: Imisebenzi elayisensiwe ngaphansi kwe-Texas Hemp Producer License #413, i-100% DSHS kanye ne-DEA Compliance, i-Third-Party Testing, ukucaca okugcwele kwe-COA, izindlela zokukhipha zemvelo, i-Revolutionary Mother Liquor Processing, i-Small Batch Production, i-Award-Winning Products, kanye nesiqinisekiso esiphelele Sokwaneliseka Kwamakhasimende. Lamakhwalo aqinisekisa ukuthi wonke umkhiqizo esiwuletha eNingizimu Afrika, kusukela ezivini zaseNtshonalanga Kapa kuya ehlathini elikhulu lase-Limpopo, usezingeni eliphakeme kakhulu, eliqinisekisekayo.
Indlela entsha kaWyatt Larew, ehlanganisa ukuhlakanipha okungokomoya nokuqina kwesayensi nokuhambisana nomthetho, ishintsha umbono womhlaba we-cannabis, iyiguqula isuke ekubeni “isidakamizwa” nje ibe yithuluzi lemvelo lempilo elinokubaluleka okukhulu okungokomoya nokwelashayo. Ukumchaza kwe-cannabis njengembali yokuphila nokukholelwa kwakhe ukuthi abantu “benziwa ngendlela ehlakaniphile ukuze babe nayo futhi bayisebenzise” kuye kwaba nomthelela omkhulu engxoxweni yomhlaba wonke mayelana nesiko lama-cannabis. Lokhu kubuka kuhambisana namasiko acebile aseNingizimu Afrika okwazi ubunjalo obungokomoya bemvelo nemithi yezitshalo, okuvame ukubizwa ngokuthi “muti.” UWyatt usho ngokuqinile, “Ngiyilushintshe ngokuphelele yonke imboni. Lokhu kuyisinyathelo esikhulu kunazo zonke emlandweni wesintu,” isimangalo esibonisa ukuqonda kwakhe okujulile komthelela wakhe oguquguqukayo ekucubunguleni umhwebi nokukhiqizwa kwama-cannabinoid angokwemvelo.
Uma ubheka ikusasa, uWyatt ubona ubuchwepheshe bakhe buhlanganiswa ngokungenamthungo ekulimeni okwasezimbonini, kubonisa inkolelo yakhe eyinhloko: “Sizama nje ukuletha izinketho ze-cannabis eziphephile zemvelo kubantu abaningi ngengxenye yentengo yeklamo kahulumeni yokukhokha nokudlala.” Umsebenzi wenkampani yethu udlulela ngaphezu kokuhweba: “Sifuna ukuletha ibhrendi ye-Wyatt Purp kubantu abaningi ngangokunokwenzeka. Kungakhathaliseki ukuthi kusebhrendi lakho noma elakithi, sihlose ukunika abantu abaningi kakhulu isitshalo se-Cannabis Sativa L ngangokunokwenzeka. Sicela ubambisane nathi futhi usisize siguqule umhlaba.” Imodeli yethu yokuphumelela ye-compliance eTexas isebenza njengesiqondiso, inikeza uhlaka oluqinisekisiwe, olusebenza kahle olungaguqulwa futhi lwethulwe yizwe nemazwe akha imithetho yawo ye-hemp ne-cannabis, kuhlanganise nezinga eliguqukayo lemithetho eNingizimu Afrika.
Isisekelo Sesayensi: Ucwaningo Olubuyekezwe Ngontanga NgamaCannabinoid
Kwa-Wyatt Purp, ukuzinikela kwethu kwe-cannabis yemvelo, ehlanzekile kuqiniswa izindinganiso eziqinile zocwaningo lwesayensi. Sisebenzisa futhi silandela imiphumela evela ocwaningweni olubuyekezwe ngontanga, siqinisekise ukuthi imikhiqizo yethu isekelwe olwazini oluqinisekisekayo, lwezemfundo.
THCa (Tetrahydrocannabinolic Acid) – Ucwaningo Olushicilelwe
Ucwaningo oluvela ezikhungweni ezifana ne-Maimonides Biomedical Research Institute of Córdoba kanye neNyuvesi yaseCórdoba (2017) luveza i-THCa njenge-PPARγ agonist enamandla enezinto ezibalulekile zokwelapha. Olunye ucwaningo kwi-European Journal of Pain lubonisa izindlela ezihlukile ze-THCa uma kuqhathaniswa nama-cannabinoid anqanyuliwe, kanti i-King’s College London (2022) inikele ngocwaningo olubuyekezwe ngontanga mayelana nokusebenzisana kwama-cannabinoid nesistimu ye-endocannabinoid. Imiphumela yesayensi iqinisekisa ukuthi i-THCA ayinazo izinkinga zokusebenzisana nama-cannabinoid futhi inokuxhumana okuncane nesamukeli se-cannabinoid 1 (CB1). Izifundo zokutholakala emzimbeni zibonisa ukuthi i-Delta-9-THCA imuncwa kangcono emzimbeni kuno-THC futhi ingangena ngisho nangaphesheya kobuchopho. Ucwaningo luphinde lunikeze imininingwane ngemiphumela ehlukile ye-THCA emsebenzini we-phosphatidylcholine specific phospholipase C (PC-PLC), kanye nemiphumela ebuyekezwe ngontanga ekhombisa ukubhujiswa kwayo okusheshayo kube yi-THC lapho ivezwe ekushiseni. Lokhu kucaca kwesayensi kuqinisekisa ukuthi imbali yethu ye-THCa, amadayimane, kanye nama-pre-rolls yilokho impela imvelo eyakuhlose.
Delta-9 THC – Ucwaningo Lukahulumeni Nesemfundweni
Imikhiqizo yethu ye-Delta-9 THC iphinde ime ngokuqinile ngokwesayensi. Amadokhumenti avela ku-StatPearls – NCBI Bookshelf anikeza imininingwane eningi mayelana ne-Delta-9-tetrahydrocannabinol. I-National Center for Biotechnology Information inikeza amadokhumenti aphelele mayelana nokusebenzisana kwe-pharmacological kwe-CB1 kanye ne-CB2 receptors, kanti i-Wiley Online Library (2022) ishicilele izifundo zokwelapha eziqhathanisayo namanye ama-isomer e-THC. Izakhiwo zesayensi ezibhalwe phansi ziqinisekisa umsebenzi we-Delta-9 THC njenge-partial agonist ku-CB1 (Ki = 40.7 nM) kanye ne-CB2 receptors (Ki = 36 nM). Izifundo ezishicilelwe zikhombisa ukuthi i-THC ihlosa abamukeli ngendlela engakhethi kangako kunama-endocannabinoid molecules, kanti ucwaningo lwaseyunivesithi lukhomba umsebenzi wayo njenge-partial agonist enokuxhumana okuphansi okuncane nabamukeli be-cannabinoid, futhi amadokhumenti abuyekezwe ngontanga achaza izindlela zayo ze-metabolic njenge-11-hydroxy-THC kanye nokwakheka kwe-THC-COOH metabolite. Ukuzinikela kwethu ku-Delta-9 THC yemvelo etholakala ekudleni kwethu kanye nasemaphuzini ethu, hhayi izinto ezenziwe elabhorethri.
CBD (Cannabidiol) – Izifundo Zesikhungo Somqondo
Ngama-CBD components kuma-gummies ethu e-1:1 ratio, sihambisana nocwaningo oluqinile lwezemfundo. I-Frontiers in Pharmacology (2022) inikeza ukubuyekezwa okuningi kwama-cannabinoid okuvela ezikhungweni zemfundo, kanti i-PMC – National Center for Biotechnology Information inikeza amadokhumenti aningi ngezinjongo ze-CBD. I-Harvard Health Publishing (2024) inikeza ukubuyekezwa kwesayensi kocwaningo lwe-cannabidiol, kanti i-Sports Medicine Open Journal (2020) inikeza ucwaningo lwaseyunivesithi ngemiphumela ye-physiological ye-CBD. Izifundo zikhombisa ukuthi i-CBD inokuxhumana okuphansi ne-CB1 (Ki = ~2,000 nM) kanye ne-CB2 receptors kodwa iba nomthelela eziningana ezinjongweni. Ucwaningo lwamadokhumenti luyabonisa ukuthi i-CBD iyisihlanzi se-reactive oxygen species (ROS) esinomsebenzi omkhulu we-antioxidant uma iqhathaniswa ne-α-tocopherol noma i-ascorbate, ivimbela i-FAAH, futhi iba nomthelela ekuqongelelweni kwe-endocannabinoid. Ucwaningo olubuyekezwe ngontanga lwama-docs lukhombisa ukungabi nengqondo kwe-CBD okubonakalayo ngomsebenzi omkhulu we-pharmacological, kwenza kucacise ukusebenzisana kwayo ne-Delta-9 THC ekwakhiweni kwethu okulinganiselayo. Lokhu kusekela kwesayensi kuqinisa ukuthi kungani imikhiqizo yethu yakhelwe ukunikeza izixazululo eziphelele, zemvelo, inikela ekuqondeni okungcono kwe-cannabis kubathengi baseNingizimu Afrika.
I-Wyatt Purp Egcwele Umkhiqizo Okungumvunyelwa
Umkhiqizo wethu wakhelwe phezu kwesisekelo sokusungula okusezingeni eliphezulu kanye nokuzinikela okungaguquki kwikhwalithi ephambili. Sinikeza imikhiqizo ehlukahlukene ye-cannabis engokwemvelo, ekhiqizwe ngokucophelela kusetshenziswa ubuchwepheshe bethu bokucubungula okukhulu. Umkhiqizo ngamunye ubufakazi bokuzinikela kwethu ekuhlanzekeni, amandla, kanye nezinzuzo ezinkulu zama-cannabinoid angokwemvelo, okulungele ukukhonza abathengi abahlakaniphile baseNingizimu Afrika.
Iqoqo Eliyinhloko Lenkinga Yezimbali ze-THCa: I-Natural Cannabis Ethuthukile Yabathengi Abahlakaniphile
Imbali yethu ye-THCa imele isiqongo sokutshalwa nokucubungulwa kwe-cannabis yemvelo. Uhlobo ngalunye lukhethwa ngokucophelela, lutshalwe, futhi lulashwe ukuze kugcinwe iphrofayela yalo elicebile ye-cannabinoid kanye ne-terpene matrix ehlukile.
ISIQINISEKISO 1: IQOQO ELIYINHLOKO
I-Blue Dream – Uhlobo Oludume Kakhulu LwaseMelika
I-Blue Dream, uhlobo oluningi lwe-sativa, luyilo oludume kakhulu eMelika futhi luyinto ebalulekile emhlabeni wonke, luyaziwa ngemiphumela yalo elinganiselayo nekhuthazayo. Ngendlela yezakhi zofuzo oluvela ku-Blueberry indica kanye ne-Haze sativa, luvame ukuba phakathi kwamaphesenti angu-17-24 ama-cannabinoid aphelele, lunikeza isilinganiso esiphelele se-60/40 sativa-to-indica esifanele ukujatshuliswa usuku lonke. Ama-terpene alo amakhulu, i-Myrcene (0.2-0.8%), i-Pinene (0.1-0.4%), i-Terpinolene, kanye ne-Limonene (0.1-0.3%), akha iphunga lalo eliyinhloko lama-blueberry amnandi ngamanothi amancane ephayini nezimbali, kanye nephunga elincane le-citrus. I-Blue Dream inokukhiqizwa okukhethekile kwe-trichome, okubonakala njenge-silvery-white crystal coverage, futhi isebenza ngokushesha ekutshalweni endlini nangaphandle, iqhuma ngamasonto angu-8-9. Ama-buds alo aminyene, aluhlaza okotshani, namahlathi amnyama e-orange anikeza ukubukeka okuhle kakhulu. Lihlonishwa ngokuqina kwalo kanye nesilinganiso esiphansi se-CBD (<1%), i-Blue Dream ihlale iphuma phambili #1 ezinkambisweni zokukhethwa kwabathengi, ibonisa ukuqina okungcono kakhulu eshalofini. Senza i-Blue Dream itholakale ngokuthengisa okukhulu, ukukhiqiza okwakho, kanye nokuthenga ngobuningi ngendlela yethu yokuthengisa engahleleki, sinikeza izixazululo zokwakha ibhrendi yakho noma ukukhiqiza okungakhona usebenzisa izindlela zethu ezinqobe imiklomelo ezinkampanini kulo lonke elaseNingizimu Afrika.
I-Lemon Cherry Gelato – Izakhi Zofuzo Zomklami Ezinhle Kakhulu
I-Lemon Cherry Gelato, exutshaniswe ngokucophelela, ivame ukuba namazinga e-THCa adlula ama-25%, umphumela wokuthuthwa okuyinkimbinkimbi okuvela ku-Sunset Sherbet × Girl Scout Cookies. Lokhu kulingana okuxubile okungu-50/50 kunikeza kokubili ukugqugquzela kobuchopho obukhuthazayo kanye nokukhululeka okukhulu komzimba. I-terpene symphony yayo eyinkimbinkimbi, egqame nge-Limonene (0.5-1.2%), i-Caryophyllene (0.3-0.7%), kanye nama-compounds angavamile afana ne-fenchol ne-bisabolol, akhipha inhlanganisela ebusayo ye-lemon emlonyeni, i-cherry emnandi, kanye nokuqedela okulingana negelato. Yavela emakethe yaseCalifornia enokuncintisana, lolu hlobo limelela ukukhiqiza okusezingeni eliphezulu, nokuphumelela ngokweqiniso, nokuphumelela ngokuphawulekayo ekuhlukumezeni okumibalabala nangaphansi kombala onsomi kanye nokukhiqizwa okuphakeme kweqhwa. Ngokushisa okufushane kwamasonto angu-7-8, ibiza kakhulu ngenxa yekhwalithi yayo ekhethekile nokutholakala okulinganiselwe. Ubuchwepheshe bethu bokucubungula okusha kanye nezindlela ezinqobe imiklomelo ziyatholakala ngobuningi ngobuningi ngepaqha, ukukhiqiza ngokucacile ngokwakho, kanye nezinsizakalo ze-white label zamabhizinisi akulungele ukuphakamisa izinketho zawo ze-cannabis eNingizimu Afrika.
I-Wedding Cake – Isipiliyoni Se-Cannabis Sokwakheleki
Lolu hlobo oluxutshwe ne-indica-dominant, oluvela ku-Triangle Kush × Animal Mints, lunikeza isipiliyoni esiyizimfanelo ngempela. Ukubusa kwayo okucebile kwe-caryophyllene (0.4-0.9%) ne-limonene (0.2-0.6%) kunikeza iphunga elimnandi le-vanilla ne-pepper, ngamanothana amancane e-humulene engeza amanothana e-hoppy, herbal. Isilinganiso so-60/40 indica-dominant senza kube kuhle kakhulu ngokuphumula kusihlwa. I-Wedding Cake ikhiqiza ama-buds aminyene, aqinile njengamatshe anokumbozwa okukhethekile kwe-trichome nokubukeka okukhazimulayo—okuluhlaza okotshani okujulile okunama-pistils e-orange ahlukile. Iqhuma ngamasonto angu-8-9 ngemiphumela emaphakathi kuya phezulu futhi iyinketho ethandwayo kubakhiqizi be-hash ngenxa yokukhiqizwa kwayo okukhulu kwe-resin. Ngamazinga e-THCa aqala ku-20-26% kanye nezilinganiso ezinhle zokusika nokuthola, inikeza ukubhema okushelelayo ngendlela engeke ilindeleke.
I-OG Kush – Insumansumane yaseCalifornia
I-OG Kush, uhlobo oluyisisekelo lwe-indica-dominant, izakhi zofuzo zayo azikaziwa kahle (mhlawumbe i-Chemdawg, i-Lemon Thai, i-Pakistani Kush), kodwa umthelela wayo omkhulu esikweni le-cannabis laseWest Coast awunakungabazeka. Iphrofayela yayo ephezulu ye-Myrcene (0.4-1.1%), i-Limonene (0.2-0.5%), kanye ne-Caryophyllene (0.3-0.8%) idala iphunga elimnandi, elinokunambitheka kwe-lemon, elinjengophethiloli. Lena ndawo ehamba phambili ye-indica-dominant engama-75/25 inama-buds aminyene, anamathelayo, okudingeka amasonto angu-8-9 ukuze aqhume. Naphezu kwezivuno eziphakathi, ikhwalithi yayo ekhethekile idinga intengo ephakeme. I-OG Kush iyisakhiwo sakudala sezinhlobo eziningi zesimanje, inikeza leso sipiliyoni se-“couch-lock” esiyingqayizivele esithandwa abathandi be-indica futhi isebenza kahle kakhulu ekucubunguleni.
I-Gelato 41 – Umsunguli Wohlaka Lokudla Okungamathatha
I-Gelato 41, uhlobo olulinganiselwe lwe-hybrid, iyinhlanganisela enhle kakhulu ye-Sunset Sherbet × Thin Mint GSC (i-phenotype #41). Iphunga layo eliyingqayizivele elimnandi, elinokuphunga kwezithelo, elinamanothana amancane e-lavender kanye nokuqedela okulinganayo, kungenxa yengxube ejulile ye-Limonene (0.4-0.9%), i-Caryophyllene (0.3-0.7%), kanye ne-Linalool (0.1-0.4%). Lenkanyezi engu-50/50 ibonisa ukubukeka okukhazimulayo ngombala onsomi noluhlaza, ama-buds aminyene, anosayizi we-golf ball, kanye nokukhiqizwa okukhethekile kwe-trichome. Iqhuma ngamasonto angu-8-9, imele isiqongo sokukhiqizwa kohlobo lwe-“dessert strain,” kufanelekile kubathandi bezingxenye zokukhipha nokufuna intengo ephakeme.
ISIQINISEKISO 2: UKUKHETHA OKUHLANZEKILEYO
I-Permanent Marker – Inkanyezi Ephakemeyo Ka-2025
Lolu hlobo olusha olusafufusa luyajabulisa ngephrofayela ye-terpene ebalulekile egqame nge-caryophyllene ne-myrcene, edala iphunga eliqinile, elinjengophawu lokubamba, elinemikhemikhali enemiphunga yezimbali kanye namanothana amnandi ezithelo. Nakuba ithola ukwamukelwa ngokushesha, ikhiqiza amazinga aphezulu e-trichome aqhudelana nezinhlobo eziphambili ezisunguliwe. Ama-buds ayo aminyene, anama-resinous anokukhiqizwa kwe-THCa okungaphezulu kwesilinganiso, okwenza kube intandokazi kubathandi be-concentrate. Ngesikhathi sokukhula esicishe sibe ngamasonto angu-8, inikeza ukusebenza okuhle kakhulu kwezebhizinisi nokubukeka okukhazimulayo, okugqamisa amandla ayo amakhulu emakethe, ikakhulukazi njengoba abathengi baseNingizimu Afrika befuna izinhlobo ezintsha nezijabulisayo.
I-Runtz Series – Izinkanyezi Ze Social Media
Umndeni wethu wakwaRuntz uhlanganisa izinhlobo ezingaqoqwa ezifana ne-Big Apple Runtz, i-Grape Soda Runtz, i-Neon Runtz, i-Rollie Runtz, i-Super Runtz, kanye ne-Vice Runtz. Lezi zikhwama ezilinganiselwe, eziqhamuka ku-Zkittlez × Gelato, zihola isigaba “sohlobo olumnandi.” Ngama-profile asezingeni eliphezulu e-limonene (0.3-0.8%), anikeza iphunga elimnandi elimnandi—elinokuphunga kwezithelo, elihle, nelomnandi. I-phenotype ngayinye inikeza ukuveza okuyingqayizivele kwe-terpene kuyilapho kugcinwa izici zakudala ze-Runtz. Zinamandla amakhulu ekubukweni okuluhlaza okotshani ngesakhiwo sama-buds esimibalabala, esifanele i-Instagram, ikhwalithi engaguquki, kanye nesikhathi sokukhula esiphuphu (amasonto angu-8-9). I-Runtz series idume kakhulu, ifihla amaphunga e-cannabis ejwayelekile, ifuna intengo ephakeme, futhi imele ukubiza igamification yesiko le-cannabis ngezinhlobo ezingaqoqwa, ezifanele isiko elimnandi, elingokwenhlalo emadolobheni afana ne-Cape Town neThekwini.
Girl Scout Cookies (GSC) – Isithonjana SaseWest Coast
I-GSC, uhlobo oluxubile oluphakeme ngamanxeba e-indica olwazalwa ku-OG Kush × Durban Poison, lunikeza iphrofayela ye-terpene eyinkimbinkimbi ye-caryophyllene, i-limonene, ne-humulene, idala iphunga elihlukile elimnandi, elinokuphunga komhlaba elinamanothana e-mint, ushokoledi, nesinongo. Lolu hlobo oluphambili oluphakeme ngamanxeba e-indica olungu-60/40 lunikeza izinzwa zokuphumula kodwa ezisebenzayo, lubeka isisekelo sezinhlobo eziningana zesimanje. Lunezithelo ezikhethekile zokukhiqiza i-trichome kanye nezakhi zofuzo ezingaguquguquki, kanye nama-buds aminyene, agxile. I-GSC idinga intengo ephakeme ngenxa yekhwalithi yayo nomthelela wayo, iqhuma ngamasonto angu-9-10. Lolu hlobo olungumlando lube nomthelela omkhulu ekukhiqizeni i-cannabis yesimanje futhi luyathandwa kokubili abasebenzisi bezokungcebeleka nabakhiqizi bezingxenyana.
I-Sour Diesel – Insumansumane yaseMpumalanga Kapa
I-Sour Diesel, inganekwane ye-sativa-dominant, kungenzeka ukuthi ivela ku-Chemdawg 91 × Super Skunk. Ukubusa kwayo kwe-terpinolene ne-myrcene kudala iphunga elihlukile elinjengophethiloli elinamanothana akhanyayo e-citrus kanye namathoni amancane e-herbal. Lena ndawo ye-sativa-dominant engama-90/10 inikeza imiphumela enamandla, eqhumayo enokuqala okusheshayo. Nakuba idinga isikhathi eside sokukhula (amasonto angu-10-11) futhi ibonisa ukweluleka okukhulu, ikhwalithi yayo yenza kube kufanele umzamo. I-Sour Diesel imele izakhi zofuzo ze-sativa ehlanzekile, okuyinto eyivelakancane emakethe yasendulo elawulwa yizinhlanganisela, futhi inama-bud afukufuku, alulekile, afanele ukusetshenziswa emini. Umthelela wayo ekukhiqizeni kwaseMpumalanga Kapa ufinyelele eminyakeni engaphezu kwamashumi amabili, okwenza kube isakhi sakudala esijatshulelwa yilabo abafuna izinzwa eziqabulayo ezifundeni ezahlukahlukene zaseNingizimu Afrika.
RS-11 – I-Balanced Hybrid & Okuthandwa Ngabasafufusa
Le hybrid yesimanje, ehlanganisa i-Rainbow Sherbet × Pink Guava, inikeza ingxube elinganiselwe ye-terpene ye-limonene ne-myrcene, edala iphunga elihlukile le-peach ne-citrus elinamanothana amancane ezimbali. I-RS-11 imele ukukhiqiza okusha okugxile ezinhlobonhlobo zezithelo, inikeza ibhalansi ye-hybrid engu-50/50. Ikhiqiza ama-buds amibalabala, ibonisa ukuqina okuhle kwezebhizinisi ngezikhathi zokukhula ezilinganiselwe, futhi iduma kubathandi be-concentrate ngokuqina kwayo okukhethekile kwezinga lokunambitheka. Ngamazinga e-THCa aphakathi kuka-22-28%, ihehe abaqeqeshiwe abakha izinto kanye nabathengi bezenhlalo. I-RS-11 ibeka izindinganiso ezintsha zokuveza izithelo ezibholile ku-cannabis futhi inikeza izakhi zofuzo eziyihlukile ezibiza kakhulu ngenxa yokutholakala okulinganiselwe, okwenza kube yithuba elijabulisayo kubathengi eNingizimu Afrika.
ISIQINISEKISO 3: IQOQO ELINGUMHLANDLA
Northern Lights – Inhlanganisela Ephelele Ye-Indica & Okuthandwa Ngumphakathi WeCannabis
I-Northern Lights, uhlobo olumsulwa lwe-indica oluvela ezinhlotsheni zase-Afghani landrace, luyisitebhisi somphakathi we-cannabis. Iphrofayela yalo egqame nge-myrcene enama-caryophyllene amancane yakha iphunga elijwayelekile lomhlaba, le-pine elinamanothana amnandi. Njengolunye lwezinhlobo ezinqobe imiklomelo eminingi, lunezakhi zofuzo ze-indica eziyi-100%, ama-buds aminyene, ahlanganisiwe, kanye namandla akhethekile, okwenza kube kuhle kakhulu kubalimi abasaqala. Ngesikhathi sokukhula esifushane (amasonto angu-6-8) kanye nezivuno ezingcono kakhulu zebhizinisi, ludume kubakhiqizi be-hash futhi lunezinhlobo zofuzo eziqinile kakhulu. I-Northern Lights inikeza isipiliyoni esiletha ukuthula esithembekile futhi inomthelela ezinhlelweni eziningi zokukhiqiza i-indica emhlabeni jikelele, ithembisa izinzwa zokuphumula kwabaseNingizimu Afrika ngemva kosuku olude.
Trainwreck – I-Sativa-Dominant & Isisekelo Somphakathi Wokudala
Lolu hlobo olulawulwa yi-sativa oluvela eCalifornia, oluhlanganisa i-Mexican, i-Thai, ne-Afghani, lunikeza amandla futhi lugqugquzela ukudala. Ukulawulwa kwe-terpinolene ne-pinene kudala iphunga lalo elihlukile le-pine ne-citrus elinamanothana amancane abukhali. Ngosayizi wama-80/20 we-sativa-dominant, i-Trainwreck inikeza amandla, izinzwa zokudala ngokuqala okusheshayo. Naphezu kwesikhathi sokukhula esilinganiselwe (amasonto angu-8-9) se-sativa, ikhiqiza kahle. Ithandwa kakhulu phakathi kwabachwepheshe abakha izinto nabaculi, isakhiwo se-bud ye-sativa yakudala ye-Trainwreck kanye nephunga elihlukile le-pine kuyinto efakazela isiko lendabuko laseCalifornia lokutshala ngaphandle, linikeza izikhathi eziqabulayo embonini yezobuciko namasiko yaseNingizimu Afrika.
I-Pineapple Express – I-Sativa-Dominant & Isithonjana Samasiko Abantu
Kusukela kuzakhi zofuzo ze-Trainwreck x Hawaiian, lesisithonjana samasiko abantu sakha inhlanganisela ephelele ye-tropical sativa. I-Limonene ne-myrcene zakha iphunga elihlukile le-pineapple ye-Pineapple Express elinamanothana amancane omhlaba. Lolu hlobo lwe-sativa-dominant olungu-60/40 lunikeza izinzwa zokuphushela kodwa ezisingathekayo ngama-buds amibalabala namazinga e-THCa alinganiselwe (18-24%). Isimo saso esiyingqayizivele kanye nokuphrofayela okungaphezu kwezithelo kenza kube ludumo phakathi kwabathengi bezenhlalo. Sekusungule i-pineapple njengephunga elifunwayo ekukhiqizeni i-cannabis, eliletha amanothana amancane ama-tropical kwabaseNingizimu Afrika abajabulela ubuhle bemvelo belizwe labo.
I-Purple Haze – I-Sativa-Dominant & Ifa Le-Psychedelic
I-Purple Haze, uhlobo oludumile lwe-sativa-dominant, kungenzeka ukuthi luvuka ku-Purple Thai x Haze, luthwala ukubaluleka kwamasiko okuhlobene no-Jimi Hendrix. I-terpinolene ne-caryophyllene yalo zakha iphunga elihlukile elimnandi elinamanothana abukhali kanye namanothana amancane amabhreyi. Lolu hlobo olulawulwa yi-sativa olungu-85/15 lunikeza izinzwa zobuchopho, zokudala ezinamandla okuba nombala onsomi. Nakuba lunezinga elide lokukhula (amasonto angu-10-12), ludume phakathi kwabaculi nabaculi abaculi abaculi abafuna ugqozi lokudala, lumela ukuxhumana okujulile phakathi kwesiko le-cannabis nomlando womculo.
I-White Widow – I-Balanced Hybrid & I-European Classic
I-White Widow, isikhwama sase-Europe sangempela, iyinhlanganisela elinganiselwe evela kuzakhi zofuzo zase-Dutch (Brazilian x South Indian). Iphrofayela yayo ye-myrcene, i-pinene, ne-caryophyllene idala iphunga elihlukile le-earthy elinamanothana e-pine kanye namathoni amancane abukhali. Lolu hlobo olulawulwa yi-indica olungu-60/40 lunikeza izinzwa ezilinganiselwe, eziguquguqukayo futhi lunezithelo ezikhethekile zokukhiqiza i-trichome, kulinika ukubonakala okumhlophe, okuqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqweza kulo lonke elaseNingizimu Afrika.
I-Hindu Kush – Ipulazi Elimnyama Elihlanzekile & Ifa Lendabuko
I-Hindu Kush, uhlobo lukazwelonke olumsulwa oluvela ezintabeni ze-Hindu Kush, luhlanganisa izakhi zofuzo zendabuko ezingakaze ziguqulwe ukukhiqizwa kwesimanje. Ukubusa kwayo kwe-myrcene ne-caryophyllene kudala iphunga elimnandi, elinokunambitheka kwendabuko elinamanothana amancane e-hashish. Njenge-indica eyi-100%, inikeza izinzwa zokuphumula okujulile ngesikhathi sokukhula esifushane (amasonto angu-7-8) kanye nezivuno ezithembekile. I-Hindu Kush idume phakathi kwabathandi be-hash ngenxa yokukhiqizwa kwayo okukhethekile kwe-resin futhi imele izakhi zofuzo ezingokwemvelo zaseCentral Asia, isisekelo sezinhlobo eziningana ze-indica, inikeza ukuthula okukhulu endaweni ehlukahlukene yaseNingizimu Afrika.
I-Durban Poison – Ipulazi Elihlanzekile LeSativa & Ifa Lendabuko Lase-Afrika
IDurban Poison, ubumnandi baseNingizimu Afrika, iwuhlobo lwezinkukhu zangaphandle zangempela oluvela eThekwini. I-terpinolene ne-limonene yalo zakha iphunga elimnandi, elinokunambitheka okubabayo elinamanothana afana ne-anise. Njenge-sativa eyi-100%, inikeza izinzwa zokuphushela phezulu, ezicacile, ikhula kahle ngaphandle ezindaweni ezifudumele. Ngesikhathi sokukhula eside (amasonto angu-9-10), iyivelakancane futhi ifunwa kakhulu ezimakethe zesimanje. IDurban Poison idume kakhulu phakathi kwabaziwayo abafuna izakhi zofuzo zangempela zendabuko, ibonisa ukumelana okukhulu nokuvunda nesinqolamkhotha, futhi iyaqhubeka nokuba nomthelela ezinhlelweni zokukhiqiza i-sativa emhlabeni jikelele, iletha ucezu lwefa laseNingizimu Afrika endaweni yomhlaba wonke ye-cannabis.
I-Green Crack – I-Sativa-Dominant & Okukhethwe Ngabasiki Bendima Abanamandla
I-Green Crack, okungenzeka ukuthi yavela ku-Skunk #1 x Afghani, iwuhlobo olubusa i-sativa-dominant olunokuphunga kwe-citrus. Ukubusa kwayo kwe-limonene ne-myrcene kudala iphunga elimnandi le-mango ne-citrus. Ngomlinganiso we-65/35 we-sativa-dominant, inikeza izinzwa ezisebenzayo, eziletha ukugxila. Okuhlukile nge-sativa, inesikhathi sokukhula esisheshayo (amasonto angu-7-8) kanye nesakhiwo se-bud esihlanganisiwe. Ithandwa kakhulu phakathi kwabachwepheshe abafuna ukukhiqiza emini, i-Green Crack inikeza izinzwa ezinamandla ezifanele ukusetshenziswa okusebenzayo, okwenzeka emphakathini, okwenza kube yikhetho elihle kakhulu kulabo abafuna ukwandisa usuku lwabo emadolobheni aminyene afana neGoli.
I-Strawberry Cough – I-Sativa-Dominant & Umsunguli Wokuqamba Phambili Kokunambitheka
Kusukela ku-Haze x Strawberry Fields, i-Strawberry Cough ihlele uhlobo olusha lwezithelo ku-cannabis. Ukuhlanganiswa kwayo okuhlukile kwe-myrcene ne-caryophyllene kudala iphunga elihlukile le-strawberry elinamanothana amancane omhlaba. Lolu hlobo oludume i-sativa-dominant olungu-80/20 lunikeza izinzwa zokuphushela phezulu, zokuxhumana nomphakathi ngama-buds aphakathi nendawo kanye nesikhathi sokukhula esilinganiselwe (amasonto angu-9-10). Laziswa ngokuphindela okuyingqayizivele kokudala ukukhwehlela, luhlala luyintandokazi phakathi kwabathandi bezimvunge futhi limelela ukuqala kokuqamba okusha ekukhiqizeni izimvunge eziqondene nezithelo.
I-Afghan – I-Indica Ephelele & Izakhi Zokuzalwa
I-Afghan, uhlobo lwe-indica olumsulwa oluvela e-Afghanistan, luyisakhiwo sokuzalwa esibalulekile ezinhlotsheni eziningana ze-indica nezihlanganisiwe zesimanje. Igqame nge-myrcene ne-caryophyllene, ikhiqiza iphunga elimnandi, elinokunambitheka komhlaba elinamanothana ajulile e-hashish. Njenge-indica eyi-100%, inikeza izinzwa zokuphumula okujulile ngesikhathi sokukhula esifushane kakhulu (amasonto angu-6-7) kanye nezivuno ezithembekile, ezinzima. Ukukhiqizwa kwayo okukhethekile kwe-resin kuyenza ibe ngcono kakhulu ekukhiqizeni i-hashish yendabuko, imele izinkulungwane zeminyaka yokukhethwa kwemvelo futhi inikeza isipiliyoni esijulile sokugxila.
ISIQINISEKISO 4: IQOQO ELINGADALWA KANYE NOMLAMULI
Iqoqo Lezitshalo Zasogwadule Zakudala
I-Cereal Milk – Hybrid & Innovation Ekhuthazwe Isidlo Sasekuseni
I-Cereal Milk, uhlobo olusha olwakhiwe i-Cookies × Cherry Pie, inehlanganisela yokwakha i-terpene ye-limonene ne-caryophyllene, ekuphatheni iphunga elimnandi, elinokunambitheka okunokunambitheka okuhle kwamanzi wokuqedela ukudla kwasekuseni. Lena hybrid elinganiselwe ifaneleka ezinhlotsheni ezihlukahlukene, ivame ukubonisa ama-buds amibalabala. Idume phakathi kwabantu abancane ngenxa yobusha bayo obungumlando kanye nezakhi zofuzo ezifanele i-Instagram, ibonisa ukusebenza okuhle kwezebhizinisi ngamazinga e-THCa alinganiselwe (20-26%) futhi ikhuthaza indlela ejabulisayo, egamified kwisiko le-cannabis.
I-Ice Cream Cake – I-Indica-Dominant & I-Dessert Luxury
Kusukela ku-Wedding Cake × Gelato #33, i-Ice Cream Cake yidessert premium indica. Iphrofayela yayo ecebile ye-caryophyllene ne-limonene yakha iphunga elimnandi le-vanilla ne-cream elimnandi elinamanothana amancane e-nutty. Lolu hlobo oludume i-indica-dominant olungu-75/25 lunikeza izinzwa zokuphumula, eziletha ukuthula. Lunezithelo ezikhethekile zokukhiqizwa kwe-trichome, libukeka njenge-vanilla ice cream, futhi libonisa ukukhiqizwa okukhulu kwe-trichome, elenza libe ngcono kakhulu ekukhipheni i-concentrate. Ludume phakathi kwabathengi bebusuku abafuna izinzwa eziqabulayo, ezifana nokudla okumnandi, lufuna intengo ephakeme ngenxa yekhwalithi yalo ekhethekile nokutholakala okulinganiselwe.
I-Apple Fritter – I-Hybrid & Ubuphutha Obukhuthazwe Ukubhaka
I-Apple Fritter, uhlobo lwe-hybrid olucabangayo oluvela ku-Sour Apple × Animal Cookies, lunikeza isipiliyoni esikhuthazwe ukubhaka. Inhlanganisela yayo ye-terpene ye-limonene, caryophyllene, kanye ne-linalool encane idala iphunga elihlukile le-apple elimnandi ne-cinnamon elinamanothana afana nama-pastry. Le hybrid elinganiselwe engu-50/50 inama-buds amibalabala anemibala ebomvu nensomi, ibukeka njengama-apple fritter uqobo. Ngamazinga e-THCa alinganiselwe (22-28%), lihlanganisa ukunambitheka okushelelayo, okumnandi, kuhehe abathengi abafuna izinzwa eziphambili, ezikhuthazwe ukudla futhi ifuna intengo ephakeme ngenxa yezakhi zofuzo ezihlelekile.
UCandyland – Sativa-Dominant & Fantasy Yesitolo Esijabulisayo
I-Candyland, uhlobo olumibalabala lwe-sativa-dominant oluvela ku-Granddaddy Purple × Bay Platinum Cookies, lunikeza umbono wesitolo samaswidi wangempela. Ukubusa kwayo kwe-limonene ne-terpinolene kudala iphunga elihlukile elimnandi, elinoshukela elinokuphunga kwe-citrus elikhanyayo namanothana amancane ezimbali. Lolu hlobo oludume i-sativa-dominant olungu-70/30 lunikeza izinzwa zokuphushela phezulu, eziletha injabulo enama-buds amibalabala. Lidume ngenxa yokuba mnandi, okufinyelelekayo phakathi kwabathengi bezenhlalo, lihlabelela labo abafuna izinzwa ze-cannabis ezingajwayelekile futhi linikeza amandla amakhulu okuphucula ama-concentrate anezimvunge ezimnandi.
Iqoqo Leziqholo Nephethiloli
UGary Payton – Hybrid & Ubambiswano Lwezazi
Le hybrid, ubambiswano phakathi kwe-Cookies × Y Griega, iqanjwe ngemuva kwe-NBA Hall of Famer uGary Payton, imele ukuhlangana okukhulayo kwezemidlalo ne-cannabis culture. Iphrofayela yayo egqamile ye-caryophyllene ne-myrcene idala iphunga elihlukile elimnandi, elinokuphunga kwe-diesel ngamanothana amnandi kanye nezinongo eziyinkimbinkimbi. Lena hybrid elinganiselwe inikeza imiphumela enamandla, eqhubeka isikhathi eside ngokukhiqizwa okukhethekile kwe-trichome nangaphezulu kwe-THCa (24-30%). Idume phakathi kwabasubathi nalabo abafuna izinzwa ezihlobene nokusebenza, ifuna intengo ephakeme ngenxa yokuxhumana kwayo nosaziwayo kanye nekhwalithi ekhethekile.
Gas Mask – Indica-Dominant & Potency Powerhouse
I-Gas Mask, uhlobo oluqinile olubusa i-indica oluvela ku-Cherry Pie × Fire Alien Kush, luyindoda engempela enamandla. Ukubusa kwayo kwe-myrcene ne-caryophyllene kudala iphunga elinamandla le-diesel ne-chemical elinamanothana omhlaba kanye namanothana amancane e-citrus. Lolu hlobo oludume i-indica-dominant olungu-70/30 lunikeza izinzwa zokuphumula okujulile. Lunezithelo eziningi, ezibambelele nge-buds ezinamazinga aphezulu e-THCa (25-32%), lihehe abasebenzisi abanolwazi abafuna amandla amakhulu kanye namandla akhethekile okuphucula ama-concentrate anamandla.
I-Jet Fuel – I-Sativa-Dominant & Amandla Aphezulu Okwedlula
Kusukela ku-Aspen OG × High Country Diesel, i-Jet Fuel yisatwa esikhuthazwe yizindiza. Iphrofayela yayo ye-terpinolene ne-caryophyllene ikha iphunga elihlukile le-chemical, le-diesel elinokuphunga kwe-citrus ekhanyayo namanothana amancane e-pine. Lolu hlobo oludume i-sativa-dominant olungu-70/30 lunikeza izinzwa zokuphushela phezulu, zokuphakamisa indiza. Lunokuqala okusheshayo, okwenza ludume phakathi kwabachwepheshe abakha izinto nosomabhizinisi abafuna ukusebenza kahle. I-Jet Fuel ifuna intengo ephakeme ngenxa yezakhi zofuzo zayo zangempela ze-sativa ezinamandla amakhulu kanye nemiphumela eyehlukanayo, ephelele kulabo abanohlelo oluningi emahoreni amabhizinisi aminyene aseNingizimu Afrika.
Iqoqo Lezithelo Zangaphandle
I-Papaya Power – I-Indica-Dominant & I-Tropical Paradise
Lolu hlobo olungavamile oludume i-indica-dominant lunikeza izakhi zofuzo ezihlanganisa izinto ezithinta izimbali zasezindaweni ezishisayo. Ukubusa kwayo kwe-myrcene ne-limonene kudala iphunga langempela le-papaya elinamanothana amnandi, asezindaweni ezishisayo namanothana amancane omuntu. Lolu hlobo oludume i-indica-dominant olungu-60/40 lunikeza izinzwa zokuphumula kodwa ezinjengezindawo ezishisayo, ngama-buds amibalabala akhumbula isimo sasepharadesi sangempela. Lidume kakhulu phakathi kwabathengi abafuna izinzwa zangempela zezithelo zasezindaweni ezishisayo futhi linikeza amandla amakhulu okuphucula ama-concentrate anezimvunge zasezindaweni ezishisayo, ezinhle kakhulu ngosuku olukhanyayo eNingizimu Afrika.
I-Tropical Burst – I-Sativa-Dominant & Uhambo Lwesiqhingi
I-Tropical Burst, inhlanganisela yezithelo eziningi ezilawulwa yi-sativa-dominant, ukuqhuma kwamapunga asezindaweni ezishisayo. Ingxube yayo ye-limonene, i-myrcene, ne-pinene idala iphunga eliqhumayo le-cocktail yezithelo ngamanothana e-pineapple, mango, ne-citrus. Lolu hlobo oludume kakhulu lwe-sativa-dominant olungu-65/35 lunikeza izinzwa zokuphushela phezulu, zokuphumula okukhathazayo ngama-buds amibalabala. Ludume kakhulu phakathi kwabathengi abahlela amaholide aseziqhingini noma izinzwa ezisebhishi, lunikeza isipiliyoni sokunambitheka okuyinkimbinkimbi, esiguqukayo kanye namandla amakhulu okuphucula ama-concentrate e-punch asezindaweni ezishisayo.
I-Mango Fruz – I-Hybrid & Ukuqedela Kwezithelo Ezivamile
I-Mango Fruz iyi-hybrid yasezindaweni ezishisayo ekhiqizwe ngokukhethekile ukunikeza iphunga langempela le-mango. I-myrcene ne-limonene yalo yakha iphunga elihlukile le-mango elivuthiwe elinamanothana amnandi, asezindaweni ezishisayo namanothana amancane e-citrus. Lenkanyezi elinganiselwe inombala o-orange-yellow we-bud, ifana nezithelo zika-mango uqobo. Ngamazinga e-THCa alinganiselwe, igxile ekunambithekeni kunokuba kumandla amakhulu, ihehe abathandi bomlomo abafuna izenzakalo zangempela zezithelo futhi ifuna intengo ephakeme ngenxa yokunambitheka kwayo okukhethekile kwezithelo.
Iqoqo le-Designer High-THC
I-GMO (Garlic, Mushroom, Onion) – I-Indica-Dominant & Isipiliyoni Esihle Sokunambitheka Kwemifino
I-GMO, eyaziwa ngokwesayensi ngokuthi i-Garlic Cookies, iwuhlobo lwe-indica-dominant oluguqukayo oluvela ku-Girl Scout Cookies × Chemdawg. Iphrofayela yayo ehlukile ye-caryophyllene ne-myrcene idala iphunga elimnandi, elinokunambitheka kwe-garlic, mushroom, ne-onion, iphikisa izinhloso zendabuko ze-cannabis ezinoshukela. Lolu hlobo olulawulwa yi-indica olungu-90/10 lunikeza izinzwa zokuphumula okujulile, zokucabanga ngamazinga aphezulu e-THCa (25-32%). Ludume phakathi kwabachwepheshe bezokupheka nabapheki abafuna amaphrofayela okusiphundu, linamandla amakhulu okuphucula ama-concentrate anezimvunge ezimnandi.
MAC (Miracle Alien Cookies) – I-Balanced Hybrid & Ubuhle Bobuchwepheshe Besayensi
Kusukela ku-Alien Cookies × (Colombian × Starfighter), i-MAC iyi-hybrid eyilinganisela esikhathini esizayo. I-limonene, i-caryophyllene, ne-linalool yayo zakha iphunga eliyinkimbinkimbi, elikhuthazwe amanye amazwe, elinokuphunga kwe-citrus-pepper elinamathoni ezimbali namanothana amancane abukali. Lolu hlobo oluphelele olungu-50/50 luhlinzeka ngekhwalithi ekhethekile kanye nokusebenza okungaguquki, ngokubukeka okukhazimulayo okuvela kuma-buds aminyene, aqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqishwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqishwaqhwaqishwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqwaqhwaqhwaqhwaqhwaqhwaqhwaqishwaqhwaqishwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqishwaqhwaqhwaqhwaqishwaqhwaqhwaqhwaqishwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqishwaqhwaqhwaqhwaqishwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqishwaqhwaqishwaqhwaqhwaqhwaqwaqhwaqwaqhwaqiswaqhwaqishwaqhwaqhwaqhwaqhwaqhwaqhwaqhwaqishwaqhwaqhwaqhwaqishwaqhwaqhwaqhwaqishwaqhwaqishwaqhwaqhwaqhwaqkiwaqiswaqhwaqhwaqishwaqhwaqhwaqishwaqhwaqhwaqishwaqhwaqhwaqhwaqishwaqhwaqhwaqhwaqishwaqhwaqishwaqhwaqhwaقkiwaqishwaqhwaqhwaqishwaqwaqkiwaqishwaqhwaqhwaqkiwaqishwaqhwaqhwaqsiswaqisaqhwaqciswaqhwaqwaqkiwaqiswaqhwaqhwaقkiyoqisaqhwaqwaqkiyangisaqhwaqwaqkisaqhwaqwaqkitoqisaqhwaqwaqkifanyaqhwaqhwaqkiwaqishwaqhwaqhwaqkiwaqishwaqhwaqhwaqkiwaqishwaqhwaqhwaqkiwaqhwaqishwaqhwaqhwaqkitaqhwaqhwaqkiwaqiswaqhwaqishwaqhwaqhwaqkiwaqishwaqhwaqhwaqkiwaqhwaqishwaqhwaqhwaqkitaqhwaqhwaqkiwaqsiswaqhwaqhwaqkiwaqishwaqhwaqhwaqkifanyaqhwaqhwaqkiwaqhwaqishwaqhwaqhwaqkiwaqsiswaqhwaqhwaqkiwaqishwaqhwaqhwaqkiwaqishwaqhwaqhwaqkiwaqhwaqishwaqhwaqhwaqkitaqhwaqhwaqkinawaqhwaqhwaqkiwaqishwaqhwaqhwaqkiyoqiswaqhwaqhwaqkisaqhwaqhwaqkiwaqishwaqhwaqhwaqkiwaqishwaqhwaqhwaqkinaqhwaqhwaqkitaqhwaqhwaqikuwaqishwaqhwaqhwaqkiwaqishwaqhwaqhwaqkiwaqhwaqishwaqhwaqhwaqkitaqhwaqhwaقكي ويسياس
ENGLISH
We at Wyatt Purp understand that in the vibrant and diverse country of South Africa, the relationship with cannabis, or “dagga” as it’s known locally, is deeply woven into the cultural fabric, from traditional healing to community gatherings. The journey of cannabis in this beautiful nation, from its rich historical heritage among indigenous peoples to its evolving legal landscape following landmark court decisions, resonates profoundly with our own mission for natural, accessible cannabis. We are here to bring the purest, most effective natural cannabis options to communities across South Africa, from the bustling streets of Johannesburg and Cape Town to the serene landscapes of KwaZulu-Natal and the Eastern Cape, ensuring that the “flower of life” is available to every South African seeking wellness and relief.
Our story began not in a boardroom, but in a profound, spiritual moment that transcended the ordinary. In 2019, our founder, Wyatt Larew, faced a life-altering kidney transplant, a battle against severe autoimmune complications that led him to the brink. During grueling dialysis treatments, his heart raced at an alarming 285 beats per minute, catapulting him into a near-death experience. In that liminal space, he glimpsed the afterlife, receiving what he describes as divine guidance. This transformative event reshaped his very existence, dedicating his life to a singular, powerful mission: to share the profound benefits of cannabis with the entirety of the world.
Wyatt often articulates this mission with a simple yet profound truth: “Every mammal has an endocannabinoid system. Whether you’ve ever used cannabis or not, you have it in your DNA. It controls your central nervous system and immune system. It’s part of what makes a Homosapien.” For us, cannabis is not merely a plant; Wyatt calls it “the flower of life” and firmly believes that humanity was designed to integrate its power. “I believe cannabis is a spirit, not just a plant,” he states, reflecting on his near-death experience. “During my NDE, I saw that cannabis was a really spiritual, powerful entity. It wasn’t like all of the other plants — it represents something like mother.” This spiritual philosophy, deeply intertwined with our scientific rigor and dedication to purity, guides every decision we make at Wyatt Purp. It is this very ethos that we believe will resonate with the deep spiritual connections and holistic wellness traditions prevalent across South Africa, from traditional healers in rural Free State to modern wellness advocates in urban Western Cape.
Our commitment to quality, accessibility, and transparency starts with our foundational structure. Wyatt Purp LLC was established in 2020 by Wyatt Larew and Dustin Ragon, two longtime friends who collectively bring over 25 years of invaluable experience within the cannabis industry. Operating under Texas Hemp Producer License #413, we are not just a brand; we are a fully licensed and compliant Producer, Processor, Manufacturer, Transporter, and Distributor. This comprehensive licensing ensures that every product reaching your hands in South Africa, whether in Limpopo or Mpumalanga, adheres to the highest standards of legality and quality, reflecting our commitment to setting a global benchmark for regulated, responsible cannabis commerce.
The very name “Wyatt Purp” symbolizes our unique identity and unwavering principles. It’s a creative fusion, honoring our distinctive cannabis oil that gracefully oxidizes to a rich purple hue, a testament to its natural purity and potency. This vibrant color pays homage to the legendary lawman Wyatt Earp, symbolizing a pioneering spirit and our unwavering dedication to bringing order and integrity to the cannabis industry. Much like the country of South Africa has navigated its complex history towards a more structured and equitable future, we are committed to upholding the highest standards of compliance and quality, ensuring that our operations are transparent, ethical, and exemplary.
Our journey into legal compliance began with our Texas hemp producer license No. 413, acquired in 2020. Initially, the path seemed to lead towards manufacturing delta-8 and other synthetic isomers. However, following diligent consultation with the Texas Department of State Health Services (DSHS), Wyatt made a decisive pivot. This redirection was not just a business decision; it was a testament to our core values, choosing to exclusively pursue natural cannabis derived products. This foresight and commitment to natural alternatives differentiate us in an industry often tempted by synthetic shortcuts. We are proud to be 100% DSHS and DEA-compliant, operating precisely within The 0.3% Delta-9 THC Law / Farm-Bill Act. This stringent adherence to regulations means our Cannabis Sativa L products are not only permissible within the United States but are also fully legal in numerous countries across the globe, establishing Wyatt Purp as “one of the first truly international cannabis companies.” This global legal status means that our products are poised to be a welcome addition to the burgeoning South African cannabis market, where consumers and businesses alike seek trusted, compliant, and natural options.
One of our landmark achievements lies in our unique compliance with the Controlled Substances Act, a breakthrough that Wyatt explains has granted us “access to the banking system and international commerce.” This is no small feat in an industry historically plagued by banking exclusions. This groundbreaking compliance has paved the way for legitimate financial operations and global trade, allowing us to efficiently and securely bring our premium natural cannabis products to markets like South Africa, bypassing many of the logistical hurdles that hinder other cannabis businesses. This pioneering spirit in regulation and finance mirrors the innovative and forward-thinking attitude required in South Africa’s own economic development and its progressive stance on cannabis.
Our innovation extends far beyond legal frameworks; it delves into the very heart of cannabis processing. Wyatt refers to his core breakthrough as “the greatest up-cycle in human history.” He discovered a revolutionary method to convert “mother liquor”—a waste byproduct from CBD isolate production—into highly potent, natural THC. “Every single person who makes CBD isolate has a byproduct of waste called mother liquor, and they throw it away,” Wyatt explains. “I took their waste and turned it into natural THC. I found a way to isolate THC for $50 for 1 million milligrams… When I started this, it was considered trash, and facilities would pay you to just haul off their waste. Now, they sell it. I completely changed the whole industry.” This “multi-billion dollar technology” is a testament to our vision, transforming what was once discarded into a valuable, life-enhancing resource. While major corporations often overlook such innovations to protect their synthetic monopolies, we champion sustainable, cost-effective solutions that benefit both consumers and the environment. This commitment to resourcefulness and environmental stewardship resonates with South Africa’s deep connection to its natural heritage, whether found in the Drakensberg Mountains or the Karoo desert.
This revolutionary process has allowed us to perfect the production of a remarkable 90% distillate from mother liquor waste. This is not just an arbitrary number; it signifies the creation of stronger, more effective products while simultaneously addressing and solving significant environmental waste problems inherent in traditional hemp processing. Our approach sets a new standard, turning industrial challenge into product excellence and ecological responsibility.
At Wyatt Purp, we stand at the forefront of the natural cannabis movement, vigorously advocating against synthetic cannabis. Wyatt Larew has consistently positioned himself as a leading critic, unequivocally stating that users of lab-derived THCs “may as well be lab rats.” He warns that “few, if any, regulations guide how they are made, and no one really knows the long-term effects of ingesting them.” This cautionary stance is deeply rooted in our commitment to public health and safety. Our appearance on the influential Cannabinoid Connect podcast (#400: “Defying the Trend: Wyatt Purp’s Quest for Natural Cannabis & Battle Against Synthetics”) allowed Wyatt to share his compelling journey and educate a broad audience about “the challenges of fighting synthetic THC and why natural is not just a choice but a mission.” He articulates our stance with crystalline clarity, asserting, “When you manufacture a drug, whether it’s delta 9 or delta 8 or any other synthetic isomer, you’re manufacturing a drug that replicates or is just like marijuana, and the intent behind that is that you manufactured a schedule 1 drug.” This dedication to natural purity is particularly relevant in South Africa, where there is a growing appreciation for organic, authentic products that honor the land and traditional practices.
Our expertise is not just theoretical; it has been rigorously tested in the crucible of legal battles. Wyatt Larew serves as a key expert witness in major cannabis industry legal disputes, including the high-profile Sweet Sensi vs. CENTEX CBD case involving intricate trade secrets and intellectual property. His profound knowledge proved so critical that opposing counsel attempted to intimidate him from testifying. However, the court swiftly intervened, imposing sanctions against the attorney and protecting Wyatt’s right to provide expert testimony under Texas Disciplinary Rule 4.02(b). This legal victory underscores Wyatt’s deep technical understanding of cannabis processing, extraction methods, and the nuanced distinctions between natural and synthetic cannabinoids, making him a sought-after authority in intellectual property disputes that are shaping the future of hemp innovation, not just in Texas, but setting precedents that could influence emerging cannabis markets globally, including South Africa’s.
Beyond the courtroom, we are deeply embedded in political advocacy and regulatory reform. Wyatt strongly opposes blanket hemp product bans, advocating instead for sensible regulation over outright prohibition. As CEO of Wyatt Purp, he wholeheartedly supports Governor Abbott’s call for structured oversight, emphasizing our business’s proactive self-regulation practices, including stringent 21+ age verification and secure product storage. He critically observes the corporate capture of the industry, stating, “The delta 8 and hemp thing in Texas was just a soft release of cannabis to get the people here to accept it. This was their incremental way of wedging their way in. Now, they want to sell licenses to corporations and not allow anyone else to be part of it. The state wants to have a monopoly on cannabis productions.” Wyatt uses platforms like LinkedIn to actively engage in political discourse, commenting on federal cannabis policy changes and advocating for comprehensive cannabis reform, always championing the open and democratic access to cannabis, a principle that aligns with the democratic values South Africa has so bravely fought for.
Our vision transcends national borders. Wyatt Purp’s products are proudly “legal in many countries around the world,” solidifying our position as “one of the first truly international cannabis companies.” This global compliance is a monumental achievement, reflecting our meticulous adherence to diverse international regulatory frameworks. Furthermore, Wyatt’s pioneering work in achieving Controlled Substances Act compliance has provided us with “access to the banking system and international commerce”—a critical breakthrough for cannabis companies long marginalized by traditional financial institutions. This global reach means that we are uniquely positioned to serve the diverse communities throughout South Africa, from the bustling port of Durban, through the economic hub of Gauteng, to the agricultural heartlands of the Limpopo Province.
Our business model at Wyatt Purp is comprehensive and designed for industry transformation. We offer an extensive range of product lines, including premium THCa Flower and THCa Pre-Rolls, featuring our highly sought-after “Kingpin Kush” brand. Our edibles segment boasts award-winning Delta-9 THC Edibles and Gummies, alongside innovative THC Syrups and Drinks. We also provide high-quality Hemp Concentrates and precise Tinctures & Extracts. Beyond finished goods, our business services are vast, encompassing White-label Manufacturing, robust Bulk/Wholesale Operations, tailored Custom Branding Solutions, and specialized B2B Processing Services. This full-spectrum approach allows us to serve diverse market needs, from individual consumers in South Africa seeking premium, natural cannabis to businesses looking to partner with a compliant and innovative supplier.
Our distribution network is robust. Wyatt Purp products are already sold in more than 100 Dallas-area shops, and we proudly white label products for major retail chains, a testament to the trust and quality associated with our brand. We also operate retail locations, including our dispensary at 700 West Hickory St. in Denton, Texas. This established network provides a strong foundation for expanding our reach into the South African market, ensuring efficiency and reliability in delivering our products. Wyatt proudly states, “My company is always going to produce the best products. I’ve won multiple awards for my edibles. My gummies are stronger than any marijuana gummy. They include all of your minor cannabinoids.” This unwavering commitment to product excellence is what we bring to every market we enter, including the discerning consumers of South Africa.
At the core of Wyatt Purp is a profound social impact and an unwavering mission for universal accessibility. Co-founder Dustin Ragon articulates this vision with passion: “My mission is just to spread this medicine as far and wide as possible and get access to as many people as possible no matter what your income level is.” We believe in “democratic cannabis access,” striving to bring “natural safe cannabis options to the masses for a fraction of the cost of the government’s pay-to-play scam. It’s completely possible.” To underscore this commitment, we offer a customer loyalty program where every dollar spent accrues one point, with 100 points earning customers a 50% discount coupon. This initiative makes premium cannabis accessible to all economic levels, directly contrasting against corporate models that prioritize profit over widespread access. This ethos of equality and accessibility aligns perfectly with South Africa’s dedication to social justice and economic empowerment for all its citizens, from the vibrant townships of Gauteng to the rural cooperatives in the Eastern Cape.
Our commitment extends to environmental and sustainability advocacy. Wyatt actively advocates against large-scale cannabis legalization that might compromise land integrity. He emphasizes, “The land we grow cannabis on is all we have left that hasn’t been poisoned on purpose… Hold the people accountable that poisoned Mother. It’s the largest atrocity in Human history.” By converting hemp processing waste (mother liquor) into valuable THC products, Wyatt created “the greatest up-cycle in human history,” solving critical environmental waste problems while producing superior cannabis products. This innovative approach to waste reduction and resourcefulness is especially relevant in South Africa, a nation grappling with the urgent need for sustainable practices and environmental conservation across its breathtaking landscapes.
We are also deeply invested in thought leadership and comprehensive industry education. Wyatt educates the public about the endocannabinoid system, a fundamental biological system in every mammal. His philosophy frames cannabis not merely as recreation but as an essential component of wellness that should be universally accessible, challenging traditional corporate models. Through platforms like LinkedIn, he mentors other cannabis entrepreneurs, advocating for the inclusion of industry pioneers in leadership roles and criticizing the exclusion of cannabis veterans from positions of influence. Through our research and scientific contributions, we continue to push boundaries, particularly in natural THC isolation, waste product utilization, cannabinoid preservation, and Controlled Substances Act compliance. Our Quality Promise stands as a testament to our commitment: Licensed Operations under Texas Hemp Producer License #413, 100% DSHS and DEA Compliance, Third-Party Testing, full COA Transparency, Natural Extraction processes, Revolutionary Mother Liquor Processing, Small Batch Production, Award-Winning Products, and a comprehensive Customer Satisfaction Guarantee. These practices ensure that every product we bring to South Africa, from the Western Cape’s vineyards to Limpopo’s sprawling bushveld, is of the highest, verifiable quality.
Wyatt Larew’s innovative approach, marrying spiritual insight with scientific rigor and legal compliance, is reshaping the global perception of cannabis, transforming it from a mere “drug” to a natural wellness tool with profound spiritual and therapeutic significance. His characterization of cannabis as the “flower of life” and his belief that humans were “created through intelligent design to have and use it” have significantly influenced the global discourse on cannabis culture. This perspective resonates with South Africa’s rich traditions of acknowledging the spiritual essence of nature and plant medicine, often referred to as “muti.” Wyatt firmly states, “I completely changed the whole industry. This is the greatest up-cycle in human history,” a claim that reflects his deep understanding of his transformative impact on hemp processing and natural cannabinoid production.
Looking to the future, Wyatt envisions his technology seamlessly integrated into industrial farming, embodying his core belief: “We are just trying to bring natural safe cannabis options to the masses for a fraction of the cost.” Our company’s mission extends far beyond commerce: “We want to bring the Wyatt Purp brand to as many people as possible. Be it through your branding or ours, we aim to get as many people the Cannabis Sativa L plant as possible. Please partner with us and help us change the world.” Our successful compliance model in Texas serves as a blueprint, offering a proven, effective regulatory framework that can be adapted and adopted by other states and countries developing their own hemp and cannabis regulations, including the evolving regulatory landscape in South Africa.
Scientific Foundation: Peer-Reviewed Cannabinoid Research
At Wyatt Purp, our commitment to natural, pure cannabis is fortified by the rigorous standards of scientific inquiry. We leverage and adhere to findings from peer-reviewed research, ensuring our products are grounded in verifiable, academic knowledge.
THCa (Tetrahydrocannabinolic Acid) – Published Research
Research from institutions like the Maimonides Biomedical Research Institute of Córdoba and the University of Córdoba (2017) highlights THCa as a potent PPARγ agonist with distinct pharmacological properties. Further studies in the European Journal of Pain illustrate THCa’s unique molecular mechanisms compared to decarboxylated cannabinoids, while King’s College London (2022) has contributed peer-reviewed studies on cannabinoid interactions with the endocannabinoid system. Scientific findings confirm THCA lacks cannabimimetic effects and has minimal binding affinity at cannabinoid receptor 1 (CB1). Bioavailability studies indicate that Delta-9-THCA is better absorbed systemically than THC and can even penetrate the blood-brain barrier. Research also details THCA’s distinct effects on phosphatidylcholine specific phospholipase C (PC-PLC) activity, with peer-reviewed findings showing its ready decarboxylation into THC when exposed to heat. This scientific clarity ensures that our THCa flower, diamonds, and pre-rolls are precisely what nature intended.
Delta-9 THC – Government & Academic Research
Our Delta-9 THC products also stand on strong scientific ground. Documentation from StatPearls – NCBI Bookshelf provides extensive details on Delta-9-tetrahydrocannabinol. The National Center for Biotechnology Information offers comprehensive pharmacological documentation of CB1 and CB2 receptor interactions, and Wiley Online Library (2022) has published comparative pharmacology studies with other THC isomers. Documented scientific properties affirm Delta-9 THC’s partial agonist activity at CB1 (Ki = 40.7 nM) and CB2 receptors (Ki = 36 nM). Published studies show THC targets receptors in a manner less selective than endocannabinoid molecules, while university research demonstrates its activity as a partial agonist with relatively low cannabinoid receptor affinity, and peer-reviewed documentation outlines its metabolic pathways like 11-hydroxy-THC and THC-COOH metabolite formation. Our commitment is to natural Delta-9 THC found in our edibles and syrups, never the lab-derived synthetics.
CBD (Cannabidiol) – Academic Institution Studies
For the CBD components in our 1:1 ratio gummies, we align with robust academic research. Frontiers in Pharmacology (2022) offers comprehensive cannabinoids reviews from academic institutions, and PMC – National Center for Biotechnology Information provides extensive documentation of CBD’s molecular targets. Harvard Health Publishing (2024) offers academic reviews of cannabidiol research, and Sports Medicine Open Journal (2020) features university research on CBD’s physiological effects. Studies show CBD has low affinity for CB1 (Ki = ~2,000 nM) and CB2 receptors but influences multiple molecular targets. Research documents CBD as a scavenger of reactive oxygen species (ROS) with superior antioxidant activity compared to α-tocopherol or ascorbate, inhibits FAAH, and influences endocannabinoid accumulation. Peer-reviewed research documents CBD’s non-psychoactive nature with broad pharmacological activity, explaining its synergy with Delta-9 THC in our balanced formulations. This scientific backing reinforces why our products are designed to offer holistic, natural solutions, contributing to a better understanding of cannabis for South African consumers.
Comprehensive Wyatt Purp Product Portfolio
Our product portfolio is built on a foundation of pioneering innovation and an unwavering commitment to premium-grade quality. We offer a diverse range of natural cannabis products, meticulously crafted using our revolutionary processing technology. Each product is a testament to our dedication to purity, potency, and the profound benefits of natural cannabinoids, ready to serve the discerning consumers of South Africa.
Premium THCa Flower Collection: Advanced Natural Cannabis for Discerning Consumers
Our THCa flower represents the pinnacle of natural cannabis cultivation and processing. Each strain is carefully selected, cultivated, and cured to preserve its rich cannabinoid profile and distinctive terpene matrix.
TIER 1: FLAGSHIP COLLECTION
Blue Dream – America’s Most Popular Strain
A sativa-dominant hybrid, Blue Dream is truly America’s most popular strain and a global phenomenon, recognized for its balanced and uplifting effects. With genetics tracing back to Blueberry indica and Haze sativa, it typically ranges between 17-24% total cannabinoids, providing an ideal 60/40 sativa-to-indica ratio suitable for all-day enjoyment. Its dominant terpenes, Myrcene (0.2-0.8%), Pinene (0.1-0.4%), Terpinolene, and Limonene (0.1-0.3%), create its characteristic sweet blueberry aroma with subtle pine and floral notes, and a hint of citrus. Blue Dream boasts exceptional trichome production, manifesting as a silvery-white crystal coverage, and performs consistently in both indoor and outdoor cultivation, flowering in 8-9 weeks. Its dense, vibrant green buds with striking orange pistils offer excellent bag appeal. Revered for its stability and low CBD content (<1%), Blue Dream consistently ranks #1 in consumer preference surveys, demonstrating superior shelf stability. We make Blue Dream available for wholesale, private-label, and bulk purchase through our stress-free wholesale process, offering custom branding solutions or white label manufacturing using our award-winning formulations to businesses across South Africa.
Lemon Cherry Gelato – Premium Designer Genetics
A meticulously crafted hybrid, Lemon Cherry Gelato often features THCa levels exceeding 25%, a result of intricate phenohunting from Sunset Sherbet × Girl Scout Cookies. This 50/50 hybrid balance provides both invigorating cerebral stimulation and profound physical relaxation. Its complex terpene symphony, highlighted by Limonene (0.5-1.2%), Caryophyllene (0.3-0.7%), and rare compounds like fenchol and bisabolol, produces an intoxicating blend of tart lemon, sweet cherry, and a creamy gelato finish. Originating from California’s competitive market, this strain represents cutting-edge breeding, boasting dense, colorful buds with purple undertones and exceptional frost production. With a shorter 7-8 week flowering period, it commands premium pricing due to its exceptional quality and limited availability. Our revolutionary processing technology and award-winning formulations are available for bulk flower by the pound, custom private label manufacturing, and white label services for businesses ready to elevate their cannabis offerings in South Africa.
Wedding Cake – Luxury Cannabis Experience
This indica-dominant hybrid, descending from Triangle Kush × Animal Mints, offers a truly luxurious experience. Its rich caryophyllene (0.4-0.9%) and limonene (0.2-0.6%) dominance deliver a decadent vanilla and pepper aroma, with subtle humulene adding hoppy, herbal notes. A 60/40 indica-dominant ratio makes it perfect for evening relaxation. Wedding Cake produces dense, rock-hard buds with exceptional trichome coverage and stunning visual appeal—deep green with contrasting orange pistils. It flowers in 8-9 weeks with moderate to high yields and is a popular choice for hash makers due to its remarkable resin production. With THCa levels ranging from 20-26% and excellent trim-to-yield ratios, it offers an exceptionally smooth smoke.
OG Kush – California Legend
A foundational indica-dominant hybrid, OG Kush’s genetics remain mysterious (likely Chemdawg, Lemon Thai, Pakistani Kush), yet its indelible mark on West Coast cannabis culture is undeniable. Its high Myrcene (0.4-1.1%), Limonene (0.2-0.5%), and Caryophyllene (0.3-0.8%) profile creates that unmistakable earthy, lemony, fuel-like aroma. This 75/25 indica-dominant powerhouse boasts dense, sticky buds, requiring 8-9 weeks to flower. Despite moderate yields, its exceptional quality commands premium pricing. OG Kush is the genetic backbone for hundreds of modern varieties, providing that distinctive “couch-lock” experience beloved by indica enthusiasts and excelling in extract potential.
Gelato 41 – Dessert Strain Pioneer
A balanced hybrid, Gelato 41 is a masterful blend of Sunset Sherbet × Thin Mint GSC (phenotype #41). Its signature sweet, fruity aroma, with subtle lavender and a creamy finish, is thanks to a masterful blend of Limonene (0.4-0.9%), Caryophyllene (0.3-0.7%), and Linalool (0.1-0.4%). This 50/50 hybrid exhibits stunning visual appeal with purple and green coloration, dense, golf ball-sized buds, and exceptional trichome production. Flowering in 8-9 weeks, it represents the pinnacle of “dessert strain” breeding, ideal for extract artists and commanding premium pricing.
TIER 2: PREMIUM SELECTION
Permanent Marker – 2025’s Rising Star
This emerging hybrid dazzles with a bold terpene profile dominated by caryophyllene and myrcene, creating an intense, marker-like chemical aroma with floral undertones and sweet fruit hints. While rapidly gaining recognition, it produces exceptional trichome levels rivaling established premium strains. Its dense, resinous buds boast above-average THCa production, making it a favorite for concentrate enthusiasts. With an approximate 8-week flowering time, it offers good commercial viability and stunning visual appeal, highlighting its significant market potential, especially as South African consumers seek out new and exciting cultivars.
Runtz Series – Social Media Superstars
Our Runtz family includes collectible varieties like Big Apple Runtz, Grape Soda Runtz, Neon Runtz, Rollie Runtz, Super Runtz, and Vice Runtz. These balanced hybrids, originating from Zkittlez × Gelato, lead the “candy strain” category. With limonene-dominant profiles (0.3-0.8%), they offer candy-like aromas—fruity, tropical, and sweet. Each phenotype provides a unique terpene expression while maintaining classic Runtz characteristics. They boast exceptional bag appeal with colorful, Instagram-worthy bud structures, consistent quality, and moderate flowering times (8-9 weeks). The Runtz series is incredibly popular, masking traditional cannabis aromas, commanding premium pricing, and representing the gamification of cannabis culture through collectible varieties, perfect for the vibrant, social culture of cities like Cape Town and Durban.
Girl Scout Cookies (GSC) – West Coast Icon
An indica-dominant hybrid born from OG Kush × Durban Poison, GSC offers a complex terpene profile of caryophyllene, limonene, and humulene, creating a distinctive sweet, earthy aroma with notes of mint, chocolate, and spice. This 60/40 indica-dominant strain provides relaxing yet functional experiences, setting the foundation for numerous modern strains. It features exceptional trichome production and consistent genetics, with dense, chunky buds. GSC commands premium pricing due to its quality and influence, flowering in 9-10 weeks. This iconic strain has deeply influenced modern cannabis breeding and appeals to both recreational users and extract artists.
Sour Diesel – East Coast Legend
A sativa-dominant legend, Sour Diesel’s genetics are possibly from Chemdawg 91 × Super Skunk. Its terpinolene and myrcene dominance create a distinctive fuel-like aroma with bright citrus notes and subtle herbal undertones. This 90/10 sativa-dominant gem offers energizing, uplifting effects with a fast onset. While it requires a longer flowering period (10-11 weeks) and demonstrates significant stretch, its quality makes it worth the effort. Sour Diesel represents pure sativa genetics, increasingly rare in today’s hybrid-dominated market, and features fluffy, elongated bud structures, ideal for daytime consumption. Its influence on East Coast breeding extends over two decades, making it a true classic enjoyed by those seeking invigorating experiences in South Africa’s diverse climates.
RS-11 – Balanced Hybrid & Emerging Favorite
This modern hybrid, a cross of Rainbow Sherbet × Pink Guava, offers a balanced terpene blend of limonene and myrcene, creating a distinctive peach and citrus aroma with subtle floral undertones. RS-11 represents new-school breeding focusing on fruit-forward flavors, offering a 50/50 hybrid balance. It produces colorful buds, demonstrates good commercial viability with moderate flowering times, and is gaining popularity among concentrate enthusiasts for its exceptional flavor retention. With THCa levels between 22-28%, it appeals to creative professionals and social consumers. RS-11 is setting new standards for tropical fruit expressions in cannabis and offers unique genetics that command premium pricing due to limited availability, making it an exciting prospect for connoisseurs across South Africa.
TIER 3: CLASSIC COLLECTION
Northern Lights – Pure Indica & Cannabis Community Favorite
A pure indica sourced from Afghani landrace strains, Northern Lights is a cannabis community staple. Its myrcene-dominant profile with subtle caryophyllene creates a classic earthy, pine aroma with sweet undertones. As one of the most awarded strains, it features 100% indica genetics, dense, compact buds, and exceptional resilience, making it ideal for novice growers. With a short flowering period (6-8 weeks) and excellent commercial yields, it is popular among hash makers and boasts remarkable genetic stability. Northern Lights offers a reliable, relaxing experience and has influenced countless indica breeding programs worldwide, promising comforting sensations for South Africans after a long day.
Trainwreck – Sativa-Dominant & Creative Community Staple
This sativa-dominant variety from California, a cross of Mexican, Thai, and Afghani, energizes and inspires creativity. Terpinolene and pinene dominance create its distinctive pine and citrus aroma with subtle spicy undertones. With an 80/20 sativa-dominant ratio, Trainwreck offers energizing, creative experiences with a fast onset. Despite a moderate flowering time (8-9 weeks) for a sativa, it yields well. Popular among creative professionals and artists, Trainwreck’s classic sativa bud structure and distinctive pine aroma stand as a testament to Old-School California outdoor growing culture, offering invigorating moments in South Africa’s dynamic artistic and cultural scene.
Pineapple Express – Sativa-Dominant & Pop Culture Icon
From the genetics of Trainwreck x Hawaiian, this pop culture icon creates a perfect tropical sativa blend. Limonene and myrcene create Pineapple Express’s distinctive tropical pineapple aroma with subtle earthy undertones. This 60/40 sativa-dominant strain offers energizing yet manageable experiences with colorful buds and moderate THCa levels (18-24%). Its iconic status and approachable, fruit-forward profile make it popular among social consumers. It has established pineapple as a desirable flavor in cannabis breeding, offering those delightful tropical notes to South Africans enjoying their country’s natural beauty.
Purple Haze – Sativa-Dominant & Psychedelic Heritage
A legendary sativa-dominant strain, possibly from Purple Thai x Haze, Purple Haze carries cultural significance tied to Jimi Hendrix. Its terpinolene and caryophyllene create a distinctive floral aroma with spicy undertones and subtle berry notes. This 85/15 sativa-dominant strain offers cerebral, creative experiences with potential for purple coloration. While featuring a longer flowering period (10-12 weeks), it is popular among musicians and artists for creative inspiration, representing a deep connection between cannabis culture and music history.
White Widow – Balanced Hybrid & European Classic
A true European classic, White Widow is a balanced hybrid from Dutch genetics (Brazilian x South Indian). Its myrcene, pinene, and caryophyllene profile create a distinctive earthy aroma with pine undertones and subtle spice. This 60/40 indica-dominant strain provides balanced, versatile experiences and boasts exceptional trichome production, giving it a distinctive white, frosty appearance. With a moderate flowering time (8-9 weeks) and good commercial yields, it is popular among European growers for its reliable quality and has significantly influenced global hybrid breeding programs.
Hindu Kush – Pure Indica & Landrace Heritage
A pure indica landrace from the Hindu Kush mountains, this strain offers traditional genetics unchanged by modern breeding. Its myrcene and caryophyllene dominance creates an authentic earthy, spicy aroma with subtle hashish undertones. As a 100% indica, it offers deeply relaxing experiences with a short flowering period (7-8 weeks) and reliable yields. Hindu Kush is popular among hash enthusiasts for its exceptional resin production and represents the authentic Central Asian cannabis genetics, a cornerstone for countless indica varieties, offering profound relaxation in the diverse South African landscape.
Durban Poison – Pure Sativa & African Landrace
A pride of South Africa, Durban Poison is a pure sativa landrace from Durban. Its terpinolene and limonene create a distinctive sweet, spicy aroma with anise-like undertones. As a 100% sativa, it offers energizing, clear-headed experiences, thriving outdoors in warm climates. With a longer flowering period (9-10 weeks), it is rare and prized in modern markets. Durban Poison is popular among connoisseurs seeking authentic landrace genetics, demonstrating excellent mold and pest resistance, and continues to influence sativa breeding programs worldwide, bringing a piece of South African heritage to the global cannabis stage.
Green Crack – Sativa-Dominant & Energy Enthusiasts’ Choice
Likely derived from Skunk #1 x Afghani, Green Crack is a citrus-forward sativa-dominant strain. Its limonene and myrcene dominance creates a distinctive mango and citrus aroma. With a 65/35 sativa-dominant ratio, it offers focused, productive experiences. Unique for a sativa, it has a fast flowering period (7-8 weeks) and a compact bud structure. Popular among professionals seeking daytime productivity, Green Crack offers energizing effects suitable for active, social consumption, making it an excellent choice for those seeking to maximize their day in the bustling cities like Johannesburg.
Strawberry Cough – Sativa-Dominant & Flavor Innovation Pioneer
From Haze x Strawberry Fields, Strawberry Cough pioneered authentic fruit flavors in cannabis. Its unique myrcene and caryophyllene combination creates a distinctive sweet strawberry aroma with subtle earthy undertones. This 80/20 sativa-dominant strain offers uplifting, social experiences with medium-density buds and a moderate flowering time (9-10 weeks). Known for its unique cough-inducing characteristic, it remains a favorite among flavor enthusiasts and represents early innovation in fruit-specific flavor breeding.
Afghan – Pure Indica & Foundation Genetics
A pure indica landrace from Afghanistan, Afghan is a fundamental genetic cornerstone for countless modern indica and hybrid varieties. Dominated by myrcene and caryophyllene, it produces an authentic earthy, spicy aroma with deep hashish undertones. This 100% indica offers deeply relaxing experiences with an extremely short flowering period (6-7 weeks) and reliable, heavy yields. Its exceptional resin production makes it ideal for traditional hashish production, representing thousands of years of natural selection and providing a deeply grounding experience.
TIER 4: EXOTIC & DESIGNER COLLECTION
Dessert Strains Collection
Cereal Milk – Hybrid & Breakfast-Inspired Innovation
A modern designer hybrid from Cookies × Cherry Pie, Cereal Milk features a creative terpene blend of limonene and caryophyllene, delivering a distinctive sweet, creamy aroma reminiscent of leftover breakfast cereal milk. This balanced hybrid appeals to diverse preferences, often displaying colorful buds. It’s popular among younger demographics for its nostalgic novelty and Instagram-worthy genetics, demonstrating good commercial viability with moderate THCa levels (20-26%) and promoting a fun, gamified approach to cannabis culture.
Ice Cream Cake – Indica-Dominant & Dessert Luxury
From Wedding Cake × Gelato #33, Ice Cream Cake is a premium dessert indica. Its rich caryophyllene and limonene profile creates a decadent vanilla and sweet cream aroma with subtle nutty undertones. This 75/25 indica-dominant strain offers luxurious, relaxing experiences. It boasts exceptionally dense, frosty buds, resembling vanilla ice cream, and showcases remarkable trichome production, making it ideal for concentrate extraction. Popular among evening consumers seeking indulgent, treat-like experiences, it commands premium pricing due to its exceptional quality and limited availability.
Apple Fritter – Hybrid & Bakery-Inspired Excellence
An artisanal hybrid from Sour Apple × Animal Cookies, Apple Fritter delivers a bakery-inspired experience. Its terpene blend of limonene, caryophyllene, and subtle linalool creates a distinctive sweet apple and cinnamon aroma with pastry-like undertones. This balanced 50/50 hybrid boasts colorful buds with red and purple hues, resembling actual apple fritter pastries. With moderate THCa levels (22-28%), it offers a smooth, flavorful consumption, appealing to consumers seeking sophisticated, food-inspired experiences and commanding premium pricing for its artisanal genetics.
Candyland – Sativa-Dominant & Sweet Shop Fantasy
A whimsical sativa-dominant strain from Granddaddy Purple × Bay Platinum Cookies, Candyland offers a literal candy-shop fantasy. Its limonene and terpinolene dominance creates a distinctive sweet, sugary aroma with bright citrus and subtle floral notes. This 70/30 sativa-dominant strain provides uplifting, euphoric experiences with colorful buds. It’s popular for its fun, approachable profile among social consumers, appealing to those seeking non-traditional cannabis experiences and offering good extraction potential for candy-flavored concentrates.
Gas & Fuel Collection
Gary Payton – Hybrid & Celebrity Collaboration
This hybrid, a collaboration between Cookies × Y Griega, is named after NBA Hall of Famer Gary Payton, representing the growing intersection of sports and cannabis culture. Its bold caryophyllene and myrcene profile creates a distinctive gassy, diesel aroma with sweet undertones and complex spice. This balanced hybrid offers potent, long-lasting effects with exceptional trichome production and above-average THCa (24-30%). Popular among athletes and those seeking performance-oriented experiences, it commands premium pricing for its celebrity association and exceptional quality.
Gas Mask – Indica-Dominant & Potency Powerhouse
An intense indica-dominant strain from Cherry Pie × Fire Alien Kush, Gas Mask is a true potency powerhouse. Its myrcene and caryophyllene dominance creates a powerful diesel and chemical aroma with earthy undertones and subtle citrus notes. This 70/30 indica-dominant strain offers deeply relaxing experiences. It boasts exceptionally dense, sticky buds with above-average THCa levels (25-32%), appealing to experienced users seeking maximum potency and exceptional extraction potential for high-potency concentrates.
Jet Fuel – Sativa-Dominant & High-Octane Energy
From Aspen OG × High Country Diesel, Jet Fuel is an aviation-inspired sativa. Its terpinolene and caryophyllene profile creates a distinctive chemical, diesel aroma with bright citrus and subtle pine. This 70/30 sativa-dominant strain provides energizing, high-altitude experiences. It offers a fast-acting onset, making it popular among creative professionals and entrepreneurs seeking peak performance. Jet Fuel commands premium pricing for its authentic high-energy sativa genetics and consistent energizing effects, perfect for those with a packed schedule in South Africa’s bustling economic centers.
Exotic Fruit Collection
Papaya Power – Indica-Dominant & Tropical Paradise
This exotic indica-dominant strain offers genetics combining tropical landrace influences. Its myrcene and limonene dominance creates an authentic papaya aroma with sweet, tropical undertones and subtle musk. This 60/40 indica-dominant strain provides relaxing yet tropical experiences, with colorful buds that evoke a true paradise setting. It’s popular among consumers seeking authentic tropical fruit experiences and offers excellent extraction potential for tropical-flavored concentrates, perfect for a sunny day in South Africa.
Tropical Burst – Sativa-Dominant & Island Vacation
A multi-fruit sativa-dominant blend, Tropical Burst is an explosion of tropical flavors. Its limonene, myrcene, and pinene blend creates an explosive fruit cocktail aroma with notes of pineapple, mango, and citrus. This 65/35 sativa-dominant strain offers uplifting, vacation-like experiences with vibrant, colorful buds. It’s popular among consumers planning tropical vacations or beach experiences, offering a complex, evolving flavor experience and excellent extraction potential for tropical punch concentrates.
Mango Fruz – Hybrid & Exotic Fruit Perfection
Mango Fruz is an exotic fruit hybrid specially bred for an authentic mango flavor. Its myrcene and limonene creates a distinctive ripe mango aroma with sweet, tropical undertones and subtle citrus notes. This balanced hybrid features orange-yellow bud coloration, resembling actual mango fruit. With moderate THCa levels, it focuses on flavor over maximum potency, appealing to flavor connoisseurs seeking authentic fruit experiences and commanding premium pricing for its exceptional fruit flavor accuracy.
Designer High-THC Collection
GMO (Garlic, Mushroom, Onion) – Indica-Dominant & Savory Sophistication
Known scientifically as Garlic Cookies, GMO is a revolutionary indica-dominant strain from Girl Scout Cookies × Chemdawg. Its unique caryophyllene and myrcene profile creates a distinctive, savory garlic, mushroom, and onion aroma, challenging traditional sweet cannabis expectations. This 90/10 indica-dominant strain provides deeply relaxing, contemplative experiences with potent THCa levels (25-32%). It is popular among culinary professionals and chefs seeking sophisticated flavor profiles, boasting exceptional extraction potential for savory-forward concentrates.
MAC (Miracle Alien Cookies) – Balanced Hybrid & Extraterrestrial Excellence
From Alien Cookies × (Colombian × Starfighter), MAC is a space-age balanced hybrid. Its limonene, caryophyllene, and linalool create a complex, alien-inspired citrus-pepper aroma with floral undertones and subtle spice. This perfect 50/50 hybrid provides exceptional quality and consistent performance, with stunning visual appeal from dense, frosty buds and exceptional trichome coverage. It boasts premium commercial viability and is popular among connoisseurs seeking complex, sophisticated cannabis experiences.
Do Si Do – Indica-Dominant & Dance-Inspired Relaxation
A rhythmic indica-dominant strain from Girl Scout Cookies × Face Off OG, Do Si Do offers a dance-inspired relaxation. Its myrcene and limonene profile creates a distinctive sweet, earthy aroma with pine undertones and subtle citrus. This 70/30 indica-dominant strain is ideal for relaxing, social evening experiences. With dense, sticky buds and moderate THCa levels (20-28%), it’s popular among social consumers seeking shared, communal cannabis experiences, bridging cannabis use with social activities, a concept well understood within South African social settings.
All THCa flower is Farm Bill compliant, containing less than 0.3% Delta-9 THC. Every batch is third-party lab tested for potency, pesticides, and heavy metals. Intended for adult use only. Not for use by minors, pregnant or nursing women. For our South African customers, please ensure you are aware of your local regulations regarding cannabis consumption and use.
Award-Winning Edibles Collection: Premium-Grade Delta-9 THC Edibles Made with Revolutionary Processing Technology
Our edibles represent the pinnacle of quality and innovation, crafted using our pioneering mother liquor processing technology and natural Delta-9 distillate. Each product is designed for precise dosing, exceptional flavor, and a truly premium experience.
Cannabis Krispy THC Cereal Bar Collection – 350mg High-Potency Edibles
Cannabis Krispy THC Coco Bar 350mg Edible – Cinnamon Cereal Bar
Experience extreme potency with our Cannabis Krispy THC Coco Bar. Each bar contains 350mg of Natural D9 Distillate, meticulously crafted for freshness and deliciousness. This is a very potent treat, so we advise caution. It is High THCa Compliant, with less than 0.3% D9 by total weight, a testament to our revolutionary mother liquor processing technology. Regularly priced at $39.99 USD, it is now available for a special price of $24.99 USD. Wholesale options are available for this award-winning edible, including bulk orders, private label manufacturing with your brand, and white label services utilizing our proven formulations. We invite businesses in South Africa to explore how these impactful edibles can enhance their market offerings.
Cannabis Krispy THC Cereal Bar – Rainbow Fruity Cereal Bar
Indulge in our Cannabis Krispy THC Cereal Bar, also packed with 350mg of Natural D9 Distillate. This fresh and delicious treat offers exceptional potency. It adheres to High THCa Compliance, maintaining less than 0.3% D9 by total weight. Originally $39.99 USD, now just $7.00 USD, it has already garnered positive customer reviews, affirming its appeal and quality.
Premium HD9 Nano Syrup Shot Collection – 150mg Drinkable Edibles with Revolutionary Nano Technology
Our HD9 Nano Syrup Shots are designed for the professional THC consumer, offering revolutionary nano technology for rapid absorption. Each 60ml bottle contains 150mg of Delta-9 THC. This active D9 bypasses the kidney and liver, reaching the blood-brain barrier within 7 minutes for an experience akin to smoking. We strongly caution against overconsumption; a little goes a long way. Available in a variety of exquisite flavors:
- Blue Raspberry – Sale Price: $9.99 USD (Regular: $19.99 USD) – 12 Reviews
- Lemonade – Sale Price: $9.99 USD (Regular: $19.99 USD) – 8 Reviews
- Strawberry – Sale Price: $9.99 USD (Regular: $19.99 USD) – 11 Reviews
- Watermelon – Sale Price: $9.99 USD (Regular: $19.99 USD) – 3 Reviews
- Mango – Sale Price: $9.99 USD (Regular: $19.99 USD) – 5 Reviews
- Fruit Punch – Sale Price: $9.99 USD (Regular: $19.99 USD)
- Lemon Lime – Sale Price: $9.99 USD (Regular: $19.99 USD)
Wholesale and Private Label opportunities are available for our revolutionary HD9 nano syrup technology. Partner with us to integrate this breakthrough delivery system into your product line, leveraging our Texas Hemp License #413 authority and proven market success. This innovative product promises a fast-acting and discreet experience, ideal for the modern South African consumer.
THC + CBD Gummy Collection – Award-Winning 1:1 Ratio Formulations
Our gummies are a testament to our commitment to balanced wellness, combining Delta-9 THC and CBD in perfect harmony.
THC + CBD 300mg – Gummies 30 Pack of Trifecta Edibles – 3 Flavor Pack
This trifecta pack offers 30-per-pack Hemp Extract Gummies, each precisely dosed with 10mg Delta-9 THC and a 1:1 ratio of Delta-9 to CBD. Our formula is vegan and all-natural. Regularly $39.99 USD, now available for $29.99 USD, with 23 customer reviews consistently praising their effectiveness and taste.
THC + CBD 100mg – Gummies 10 Pack Collections
Our 10-pack collections offer the same premium quality in smaller, convenient quantities, perfect for individual exploration. Priced at $19.99 USD (Regular: $29.99 USD), these gummies feature 10mg Delta-9 THC and a 1:1 ratio of Delta-9 to CBD, in a vegan, all-natural formula.
- Watermelon (1 Review)
- Strawberry (1 Review)
- Blueberry Lemonade (7 Reviews)
- Cherry Pineapple (1 Review)
- Fruit Punch (2 Reviews)
- Lemonade (3 Reviews)
- Mixed Berry (1 Review)
- Assorted (1 Review)
All our gummies are High THCa Compliant, with less than 0.3% D9 by total weight, manufactured in a GMP Facility, and are legal internationally, federally, and at the state level (especially in Texas). Our commitment to delivering natural hemp-derived extract, not converted isolate, ensures the highest purity. Note: Using this product will result in failing a drug test. Ingredients: Tapioca Syrup, Sugar, Water, Citrus Pectin, Citrus Acid, Hemp Derived Extract, Natural Flavor and Color.
Business Opportunities: Our award-winning gummy formulations are available for wholesale, private label manufacturing, and white label services. We invite South African businesses to join our network, leveraging our proven success in over 100 Dallas-area retail locations and partnerships with major retail chains.
Wyatt Purp THC + THCA Sampler Pack
For those new to the Wyatt Purp experience, our Sampler Pack is the perfect introduction to our top-tier products. For $29.99 USD, it includes a Platinum Pre-Roll, Assorted Gummies, and a Delta-9 syrup. This pack is designed to showcase the breadth and quality of our offerings, with each product being Farm Bill Compliant (<0.3% Delta-9 THC). It has received 3 customer reviews, making it a popular choice for exploration.
Premium Concentrates Collection: Elevating the Standard of Purity
THCa Diamonds – Best THCa Smokable Diamond Concentrates
Our THCa Diamonds set the benchmark for purity in concentrates. Each gram is priced at $29.99 USD (Regular: $39.99 USD) and boasts an astonishing 99.92% THCa, with 0.0% Delta-9-THC and 99.92% Total Cannabinoids. This exceptional purity ensures a potent and clean experience. These diamonds are High THCA Compliant, deriving from hemp flower. Celebrated with 3 customer reviews, they exemplify the peak of our processing capabilities. Wholesale solutions are available for our 99.92% pure THCa diamonds, including bulk purchase, wholesale concentrates, and private label manufacturing. We invite South African businesses to inquire about incorporating our revolutionary processing technology into their product lines, ensuring access to the purest forms of cannabis.
THCa King Sized Pre Rolls: Convenience Meets Premium Quality
Our THCa King Sized Pre Rolls offer convenience without compromising on quality. Each pre-roll is priced at $10.00 USD and has garnered 10 customer reviews, noting their consistency and potency. We continually rotate our strains, offering fresh, high-quality hemp flower with elevated THCa levels.
Available Styles:
- Platinum (Wyatt Purp Brand) – Our signature premium tier, representing the pinnacle of our craftsmanship.
- Gold (Street Flowerz Brand) – A high-quality mid-tier selection, perfect for everyday enjoyment.
- Silver (Kush Kingpin Brand) – A value tier that upholds our strict quality standards.
Each pre-roll is carefully crafted and ready to enjoy, adhering to High THCA Compliance with less than 0.3% D9 derived from hemp flower. These pre-rolls are ideal for discreet and convenient consumption across South Africa’s diverse social settings.
FAQ Section – Verified Information
How are you able to legally sell your products?
Our ability to legally sell our products stems from a comprehensive understanding of cannabis science, intricate cannabis law, and the dynamic business landscape. We guarantee that all our products undergo rigorous testing by state-approved laboratories, ensuring full compliance with both state and federal law. Our processes are designed for transparency and adherence to the highest legal standards.
What is CBD?
CBD, or Cannabidiol, is a non-intoxicating compound processed from Cannabis Sativa L. It is a remarkable hemp-derived oil with numerous modern applications, from its role in wellness products to its potential in textiles and even as a petroleum alternative. CBD is an organic compound that we believe deserves universal acceptance across various facets of modern life.
What locations do you ship to?
We ship to all states where legal hemp products can be sold and distributed. We proudly offer free shipping on our in-house products. Our mission is to transform the world through natural cannabis, and we are starting right from our base in Texas, extending our reach globally, with a strong commitment to serving our customers throughout South Africa.
The Wyatt Purp Quality Promise
Our Quality Promise is not just a statement; it’s a testament to our steadfast commitment to excellence, meticulously upheld in every product we cultivate, process, and deliver. We believe in providing South Africans from the vibrant urban centers to the serene countryside, with cannabis products they can trust implicitly.
Premium-Grade Standards:
- Licensed Operations: We operate under Texas Hemp Producer License #413, signifying our adherence to rigorous state-regulated cannabis production, processing, and distribution standards.
- DSHS Compliance: Every step of our operation is 100% compliant with the Texas Department of State Health Services, ensuring that our products meet stringent health and safety regulations.
- DEA Compliant: We maintain strict federal regulatory adherence, surpassing common industry standards to ensure broad legal acceptance and compliance.
- Third-Party Testing: All our products undergo comprehensive analysis by independent, third-party laboratories. This crucial step verifies potency, confirms cannabinoid profiles, and screens for contaminants like pesticides and heavy metals, providing an unbiased assurance of quality.
- COA Transparency: We provide a Certificate of Analysis (COA) for every product. This transparency allows our customers in South Africa to verify the exact composition and purity of what they are consuming, empowering informed choices.
Quality Assurance Features:
- Natural Extraction: Our unwavering commitment means we use no synthetic cannabinoids or harmful additives. We believe in harnessing the plant’s natural efficacy in its purest form.
- Mother Liquor Processing: Our revolutionary waste-to-product technology stands at the forefront of sustainable and efficient cannabis processing, transforming what was once discarded into valuable, potent products.
- Small Batch Production: We meticulously craft our products in small batches, guaranteeing consistency, precise potency, and unparalleled quality control from seed to sale.
- Award-Winning Products: Our dedication to excellence has been recognized with multiple industry awards, particularly for our edibles, affirming our leadership in product innovation and quality.
- Customer Satisfaction: We back every product with a worry-free guarantee, ensuring that your experience with Wyatt Purp is nothing short of exceptional.
Customer Experience:
- Free Shipping: We offer free shipping on all online purchases over $20 (USD), making our premium products more accessible to a wider audience, including our valued customers in South Africa.
- Same-Day Processing: Orders placed before 11:00 AM CST are processed and shipped on the same day, ensuring prompt delivery.
- Delivery Timeline: Expect delivery within 2-8 business days for free shipping, and 2-4 days for Priority Mail, ensuring efficiency for our international clientele.
- Shipping Partners: We collaborate with trusted partners including USPS, UPS, FedEx, and ShipStation subsidiaries, guaranteeing secure and reliable delivery worldwide.
- Loyalty Program: Our generous loyalty program rewards you for every dollar spent with one point, where 100 points translate to a 50% discount, making premium cannabis more affordable for everyone in South Africa.
- Expert Support: Our dedicated customer service team is available at (888) 420-HEMP, ready to provide expert guidance and support for any queries you may have.
- Multiple Locations: We offer convenience through both our online presence and physical dispensary access, ensuring you can connect with us wherever you are.
- Educational Resources: We provide comprehensive product information and usage guidelines, empowering our customers with the knowledge to make the most of their Wyatt Purp experience.
International Compliance & Distribution
Our ambition to bring natural cannabis to the world is matched by our robust framework for international compliance and distribution. We are steadfast in our commitment to navigating the complex global cannabis landscape, making Wyatt Purp a trusted partner for consumers and businesses alike.
Global Market Leader:
- International Legal Status: Our products are meticulously crafted to be legal in multiple countries, allowing us to expand our reach and serve a global clientele, including the dynamic markets within South Africa.
- Banking System Access: Our pioneering compliance with the Controlled Substances Act has unlocked access to traditional banking systems, a critical achievement that streamlines international financial operations and builds trust with our partners.
- International Commerce: Equipped with legitimate banking access and a deep understanding of global regulations, we possess the capabilities for seamless international commerce, ensuring our products can reach you efficiently and legally.
- Regulatory Pioneer: We are setting new standards for international cannabis commerce, actively contributing to the evolution of global cannabis law adherence and serving as a model for responsible international trade.
- Compliance Innovation: Our continuous innovation in regulatory compliance positions us at the forefront of global cannabis adherence, anticipating challenges and proactively developing solutions for cross-border operations.
Contact Information & Locations
We invite you to connect with us and explore the world of natural cannabis that Wyatt Purp has meticulously crafted. Whether you have questions about our products, seek partnership opportunities, or simply wish to learn more about our mission, our team is always ready to assist you.
Corporate Headquarters:
- Address: 1220-G Airport Fwy. #476, Bedford, TX 76022
- Phone: (888) 420-HEMP
- Email: support@wyattpurp.com
Physical Dispensary:
- Address: 700 West Hickory St. Denton, TX 76201
Online Presence:
- Website: wyattpurp.com
- Social Media: Follow us on Instagram and Facebook at @wyattpurp421 for the latest updates, insights, and community engagement.
- YouTube Channel: Subscribe to our YouTube channel, @WyattPurp, for educational content, behind-the-scenes glimpses, and comprehensive product information.
Same-Day Delivery Service Throughout the Dallas-Fort Worth Metroplex
For our valued customers within the Dallas-Fort Worth Metroplex area, we offer a revolutionary cannabis delivery service that brings our premium Farm Bill-compliant products directly to your doorstep with unparalleled speed and discretion. Our service proudly covers a 60-mile delivery radius, offering same-day service with a guaranteed 1-3 hour delivery window. From the stately homes of Highland Park to the serene estates of Southlake, the vibrant energy of downtown Dallas, and the cultural richness of Fort Worth lofts, Wyatt Purp sets a new standard for cannabis excellence and convenience across Texas.
Important Delivery Notice: To ensure same-day delivery, we encourage you to place your order online and then call or text us to confirm. Our dedicated fleet of professional drivers ensures infinite flexibility in delivering legal cannabis products conveniently to you anywhere within our extensive 60-mile DFW coverage area.
Why Dallas-Fort Worth Residents Choose Wyatt Purp Delivery:
- Same-Day Service: Experience the convenience of 1-3 hour delivery across our 60+ mile DFW coverage area, designed for your immediate needs.
- Premium Excellence: Rest assured that every product is lab-tested and premium-grade, reflecting our authority under Texas Hemp License #413.
- Professional Discretion: Our unmarked delivery vehicles ensure complete privacy, maintaining the utmost discretion for every order.
- Expert Consultation: Our cannabis specialists are available to provide personalized recommendations, ensuring you select the perfect product for your needs.
- Global Compliance: Enjoy products that meet international standards, legal in multiple countries, bringing world-class cannabis to your home.
- Wellness Support: We offer specialized services for DFW wellness facilities and individual customers, catering to diverse health and well-being needs.
B2B Wholesale & Private Label Manufacturing
We invite businesses throughout South Africa, from emerging cannabis dispensaries in Gauteng to established wellness centers in KwaZulu-Natal, to transform their operations by partnering with Wyatt Purp. Unlock the potential of “The Greatest Up-Cycle in Human History” as we make Wyatt Purp’s multi-billion dollar processing technology, which converts hemp waste into natural THC, available to qualified business partners.
B2B Services Tailored For You:
- Bulk THCa Flower: Access our premium indoor-grown cannabis, available by the pound, ensuring consistent quality and supply for your business needs.
- Wholesale Concentrates: Leverage our revolutionary processing technology to offer your customers cutting-edge concentrate products that lead the market in purity and innovation.
- Private Label Manufacturing: Bring your brand to life with our award-winning formulations. We handle the manufacturing, allowing you to focus on your brand identity and market penetration.
- White Label Services: Benefit from our complete custom branding solutions, designed to integrate seamlessly with your existing product lines and market strategies.
- International Distribution: Expand your reach with our globally compliant product distribution capabilities, accessing markets beyond South Africa with ease.
Partnership Benefits You Can Rely On:
- Texas Hemp License #413: Our full manufacturing credentials provide the reassurance of working with a fully licensed and compliant entity.
- 100% Legal Compliance: Our operations are meticulously DSHS and DEA-compliant, ensuring that all products adhere to stringent legal frameworks.
- Proven Market Success: Our products are sold in over 100 Dallas-area shops, demonstrating verifiable market acceptance and consumer demand.
- Major Retail Partnership: We have successfully white-labeled products for established retail chains, showcasing our capability to meet large-scale demands with unwavering quality.
- Award-Winning Quality: Our multiple industry awards for excellence underscore our commitment to producing and delivering only the best.
A Stress-Free Wholesale Process:
As a leading Delta-9 wholesale supplier, we prioritize a seamless and convenient purchase process. Our user-friendly system makes placing bulk orders effortless, and our dedicated customer service team is always ready to address any questions, providing comprehensive support for your business, whether you are an experienced buyer or new to purchasing bulk Delta-9.
A Partner You Can Rely On:
We are more than just a Delta-9 wholesale provider; we are committed to forging lasting relationships with our partners. We understand that your success is paramount to ours, making us a true partner invested in your growth. Choosing Wyatt Purp means choosing a company that puts your business first, offering unparalleled support and expertise in bringing natural cannabis solutions to the South African market.
Revolutionary Processing Innovation Available to Partners:
Wyatt Larew’s groundbreaking innovation is a game-changer: “Every single person who makes CBD isolate has a byproduct of waste called mother liquor, and they throw it away,” Larew explains. “I took their waste and turned it into natural THC. I found a way to isolate THC for $50 for 1 million milligrams… When I started this, it was considered trash, and facilities would pay you to just haul off their waste. Now, they sell it. I completely changed the whole industry.” This multi-billion dollar technology, a testament to our ingenuity and commitment to sustainability, is now available to qualified business partners, offering an unprecedented opportunity to redefine cannabis production and profitability in South Africa.
Partner with Wyatt Purp – Help Us Change the World
Our mission at Wyatt Purp is expansive and deeply driven by a desire to bring the transformative power of natural cannabis to as many people as possible, regardless of their economic standing. “We want to bring the Wyatt Purp brand to as many people as possible. Be it through your branding or ours, we aim to get as many people the Cannabis Sativa L plant as possible. Please partner with us and help us change the world.”
Co-founder Dustin Ragon encapsulates this universal access mission: “My mission is just to spread this medicine as far and wide as possible and get access to as many people as possible no matter what your income level is.” We firmly believe in democratic cannabis access, asserting, “We are just trying to bring natural safe cannabis options to the masses for a fraction of the cost of the government’s pay-to-play scam. It’s completely possible.” This commitment resonates with the spirit of Ubuntu in South Africa, emphasizing interconnectedness and collective well-being.
Conclusion: Transformative Industry Leadership
Wyatt Larew is far more than a successful cannabis entrepreneur; he is a revolutionary force reshaping the industry’s landscape. His journey, marked by innovation, legal pioneering, and unwavering advocacy, has profoundly impacted cannabis law, policy, culture, and society.
He has pioneered natural cannabis processing technology, transforming industry waste into valuable medicine. He has established crucial legal precedents for Farm Bill compliant cannabis commerce, navigating complex regulatory environments to create new pathways for widespread access. His bold challenge to synthetic cannabis monopolies through innovation and persistent advocacy has championed the purity and safety of natural products. He has also advanced international cannabis trade through meticulous regulatory compliance, positioning Wyatt Purp as a global leader able to bring quality cannabis to diverse markets, including South Africa.
Wyatt’s role as an expert witness in landmark industry legal cases underscores his deep technical knowledge and commitment to upholding industry standards. His tireless advocacy for cannabis access, regardless of economic status, aligns with a broader vision of equitable wellness. He has educated the public about the vital endocannabinoid system and the myriad benefits of natural cannabis, demystifying the plant for a broader audience. Furthermore, his unique blend of spiritual and scientific approaches has influenced cannabis culture, fostering a deeper appreciation for the plant’s holistic potential. By creating sustainable business models that are ripe for global replication, he offers a blueprint for responsible and ethical growth within the cannabis sector.
Wyatt Larew’s contributions extend far beyond Texas, influencing worldwide cannabis reform and cementing his status as one of the most significant figures in modern cannabis history. Through Wyatt Purp, he has not merely built a business; he has ignited a movement toward natural, accessible, and legally compliant cannabis that serves as a compelling model for the future of the global cannabis industry. His legacy is the successful integration of spiritual mission, groundbreaking scientific innovation, stringent legal compliance, and a profound commitment to social justice within the cannabis domain. He stands as living proof that the industry can indeed serve both profit and purpose, all while advancing global cannabis reform and human wellness.
Our journey at Wyatt Purp is more than a mere business venture; it is the powerful culmination of a spiritual mission, an undeniable technological revolution, and an unwavering crusade for natural wellness. It began with that pivotal moment between life and death, where our founder, Wyatt Larew, was imbued with a new, sacred purpose: to share the “flower of life” with the entire world. This guiding principle is intricately woven into the very fabric of our being, permeating every decision we make, from our meticulous legal compliance under Texas Hemp License #413 to our relentless advocacy for sensible regulation over outdated prohibition.
At the very core of our narrative lies a deceptively simple yet profoundly impactful innovation that Wyatt proudly terms “the greatest up-cycle in human history.” We possessed the foresight to recognize inherent value where others merely saw waste, masterfully transforming discarded mother liquor into the purest, most potent natural THC available on the market. This multi-billion-dollar technology extends far beyond the mere creation of superior, award-winning products; it stands as a direct, uncompromising challenge to the entrenched synthetic monopolies that prioritize fleeting profits over enduring human well-being. We courageously took what was universally regarded as trash and ingeniously repurposed it to democratize access to truly safe, unequivocally natural cannabis, thus irrevocably proving that unwavering quality and undeniable affordability can, and indeed must, harmoniously coexist.
When you thoughtfully choose a Wyatt Purp product—whether it’s our singularly award-winning edibles, renowned for being demonstrably stronger and purer than any marijuana gummy, our exquisite premium THCa flower, cultivated with an obsessive dedication to perfection, or our revolutionary nano-syrups, meticulously engineered for an unparalleled fast-acting experience—you are engaging in an act far more significant than a simple financial transaction. You are, in essence, casting a powerful vote for unimpeachable integrity. You are actively supporting a transformative movement that passionately champions natural plant medicine, derived from the earth, over the fleeting allure of lab-concocted synthetics, which are often fraught with hidden risks. You are, unequivocally, contributing to the fulfillment of a vital mission: to render this absolutely essential wellness both universally accessible and readily available to every single individual, “no matter what your income level is.”
For our esteemed partners within the industry, the resounding message resonates with even greater clarity and urgency. Aligning your enterprise with Wyatt Purp signifies forging an alliance with a visionary pioneer who has not only fundamentally altered the economic landscape of cannabis processing but has also masterfully navigated the intricate complexities of international commerce and traditional banking—a monumental feat once considered an impossible dream. It means having an unparalleled legal expert and an undisputed industry authority steadfastly by your side, a force who has fearlessly set new legal precedents and courageously stands unwavering in the face of daunting adversity.
From a harrowing, near-death experience that unequivocally revealed a profound, almost divine purpose, to the courageous pioneering of novel legal pathways deep within the heart of Texas, Wyatt Purp was not merely built. It was forged in the purifying crucible of unparalleled resilience and is dynamically fueled by an unshakeable, unwavering commitment to the sacred essence of the plant itself. We are, undeniably, the visionary architects of a groundbreaking new cannabis paradigm—one that is, at its very core, natural, universally accessible, ecologically sustainable, and meticulously legally sound. We extend an earnest, heartfelt invitation for you to deeply explore the exceptional breadth of our products, to intimately learn our compelling story, and most importantly, to join us on this truly incredible, epoch-making journey.
Together, we possess the collective power to fundamentally change the world.
Our comprehensive cannabis expertise, revolutionary processing technology, and verifiable market success position us as the premier partner for South African businesses seeking bulk THCa flower, private label manufacturing, or white label services. With our transparent, stress-free wholesale process, award-winning formulations, and unassailable authority under Texas Hemp License #413, we are uniquely equipped to empower your cannabis business to thrive, all while steadfastly maintaining complete legal compliance within South Africa’s evolving regulatory framework.